Группа крови человека: Группа крови ABO

Содержание

Группа крови ABO

Группа крови ABO – это система, отражающая наличие или отсутствие антигенов на поверхности эритроцитов и антител в плазме крови. Определение группы крови имеет огромное значение при переливании крови и ее компонентов.

Синонимы русские

Группа крови, определение группы крови.

Синонимы английские

ABO Grouping, Blood Typing, Blood Group, Blood Type.

Метод исследования

Реакция агглютинации.

Какой биоматериал можно использовать для исследования?

Венозную кровь.

Как правильно подготовиться к исследованию?

  • Исключить из рациона жирную пищу за 24 часа до исследования.
  • Не курить в течение 30 минут до исследования.

Общая информация об исследовании

Группа крови АВO – это система, отражающая наличие или отсутствие антигенов на поверхности эритроцитов и антител в плазме крови. ABO (читается как «а-бэ-ноль») является самой распространенной системой групп крови в России.

Эритроциты на своей поверхности несут сигнальные молекулы – антигены — агглютиногены. Двумя основными антигенами, встроенными в молекулу эритроцитов, являются А и В. Группы крови определяются на основании наличия или отсутствия этих антигенов. Кровь людей, у которых на эритроцитах присутствует антиген А, относится к второй группе – A (II), кровь тех, у кого на эритроцитах – антиген В, относится к третьей группе – B (III). Если на эритроцитах присутствуют и антигены А, и антигены В – это четвертая группа – AB (IV). Бывает и так, что в крови на эритроцитах не определяется ни одного из этих антигенов – тогда это первая группа – O (I).

В норме организм вырабатывает антитела против тех антигенов (А или В), которых нет на эритроцитах – это агглютинины находящиеся в плазме крови. То есть у лиц со второй группой крови – А(II) – на эритроцитах присутствуют антигены A, а в плазме будут содержаться антитела к антигенам В – обозначаются как анти-B (бета-агглютинин). Так как одноименные антигены (агглютиногены) на поверхности эритроцитов и агглютинины в плазме (A и альфа, B и бета) вступают друг с другом в реакцию и приводят к «склеиванию» эритроцитов, они не могут содержаться в крови у одного человека.

Открытие групповой системы ABO позволило понять, почему переливание крови иногда происходило удачно, а иногда вызывало тяжелые осложнения. Было сформулировано понятие совместимости групп крови. Например, если человеку со второй группой крови – А(II), которая содержит антитела к антигену В, перелить третью группу крови – B (III), произойдет реакция между антигенами и антителами, которая приведет к склеиванию и разрушению эритроцитов и может иметь тяжелые последствия вплоть до летального исхода. Поэтому группы крови при переливании обязательно должны быть совместимы.

Группа крови определяется по наличию или отсутствию склеивания эритроцитов с использованием сывороток, содержащих стандартные антигены и антитела.

В центрах переливания крови на пакетах с кровью или с ее компонентами, полученными от доноров, помечается «O (I)», «A (II)», «B (III)» или «AB (IV)», что позволяет быстро найти кровь нужной группы, когда она требуется.

Для чего используется исследование?

Чтобы узнать, какую кровь можно безопасно переливать пациенту. Крайне важно убедиться, что донорская кровь совместима с кровью реципиента – человека, которому ее собираются переливать. Если в донорской крови или ее компонентах есть антитела к антигенам, содержащимся на эритроцитах реципиента, то может развиться тяжелая трансфузионная реакция, вызванная разрушением эритроцитов в сосудистом русле.

Когда назначается исследование?

  • Перед переливанием крови – как тем, кому оно требуется, так и донорам.

Переливание крови и ее компонентов чаще всего требуется в следующих ситуациях:

    • тяжелая анемия,
    • кровотечение, возникшее во время или после операции,
    • тяжелые травмы,
    • массивная кровопотеря любого происхождения,
    • онкологические заболевания и побочные эффекты химиотерапии,
    • нарушения свертываемости крови, в частности гемофилия.
  • Перед хирургическим вмешательством.

Что означают результаты?

Результаты показывают принадлежность крови человека к одной из четырех групп, в зависимости от наличия антигенов на эритроцитах и антител, присутствующих в крови.

Группа крови

Антитела

O (I)

α и β

A (II)

β

B (III)

α

AB (IV)

Антител α и β не будет

 

Правила сложения: что можно узнать о будущем ребенке по своей группе крови | Статьи

Руководитель департамента по развитию медицины BestDoctor Юлия Ткаченко сообщила 30 августа «Известиям», что первая группа крови является универсальным донором, то есть кровь этой группы можно переливать любым пациентам. Закон, однако, предписывает переливать кровь только пациентам с идентичными группами. Что такое группа крови и какие подробности о будущем ребенке можно узнать по группам крови родителей, разбирались «Известия».

Сколько бывает групп крови

Группа крови — один из важнейших факторов, определяющих биологические данные нашего организма. В частности, знать свою группу крови следует на случай необходимости переливания или срочного донорства. Это не меняющийся в течение жизни признак, передаваемый по наследству. Всего существуют четыре группы крови, определяемых зависимости от наличия на поверхности эритроцитов тех или иных белков, называемых аглютиногенами, и белков, находящихся в плазме, — аглютининов. В самой распространенной и принятой в России классификации это 0 (ноль) — первая, А — вторая, В — третья и АВ — четвертая. Именно так и подбирается кровь при необходимости переливания.

Фото: РИА Новости/Владимир Песня

«В настоящее время по закону переливать кровь можно только с идентичными группами (первую — первой, вторую — второй и т.д.). Но если исходить из биологии, то первая группа крови является универсальным донором (ее можно переливать любой другой группе), а четвертая — универсальным реципиентом (человеку с четвертой группой можно перелить любую из групп)», — объяснила «Известиям» руководитель департамента по развитию медицины BestDoctor Юлия Ткаченко.

К открытию групп крови привели в конце XIX века исследования австрийца Карла Ландштайнера. Изучая эритроциты — красные кровяные клетки, ученый обнаружил определенные закономерности. Так, в образцах крови одних пациентов Ландштайнер выделил особый маркер (он обозначил его буквой А,чем и положил начало будущей классификации). У других маркер был иным, В, у третьих не находилось ни того,ни другого. Позднее, с развитием биологии, ученые сумели установить что маркеры Ландштайнера — это особые белки, определяющие видовую специфичность клеток, или антигены. Так все человечество было поделено по трем группам крови,

а в 1902 году ученики Ландштайнера Декастелло и Штурли описали и четвертую группу крови. Сам Ландштпйнер в 1930 году был удостоен за свое революционное открытие Нобелевской премии. 14 июня, в день рождения ученого, с 2005 года проводится Всемирный день донора крови.

Как наследуется группа крови

Как уже говорилось, группа крови — наследуемый признак и передается с генами родителей потомству. Таким образом, ребенок, по идее, должен наследовать группу крови одного из родителей. Однако не всё так просто. Поскольку открытые еще Грегором Менелем рецессивные и доминантные признаки при наследовании распространяются и на кровь, ребенок имеет несколько вариантов группы крови. Наибольшее число таких вариантов у детей родителей с группами крови 0 и АВ.

Фото: ИЗВЕСТИЯ/Павел Волков

При этом, по данным науки, в семье, где у одного из родителей группа крови АВ, никогда не может родиться ребенок с группой крови 0, какая бы группа ни была у второго родителя. Это правило работает и в обратную сторону: если у отца или матери первая группа, то рождение детей с кровью АВ в таком браке невозможно. С остальными группами крови вариации можно для простоты свести в таблицу:

Автор цитаты

• У родителей с первой группой крови может родиться ребенок только с первой группой.

• У родителей со второй — ребенок с первой или второй.

• У родителей с третьей — ребенок с первой или третьей.

• У родителей с первой и второй — ребенок с первой или второй.

• У родителей с первой и третьей — ребенок с первой или третьей.

• У родителей с второй и третьей — ребенок с любой группой крови.

• У родителей с первой и четвертой — ребенок с второй и третьей.

• У родителей с второй и четвертой — ребенок с второй, третьей и четвертой

• У родителей с третьей и четвертой — ребенок с второй, третьей и четвертой.

• У родителей с четвертой — ребенок с второй, третьей и четвертой.

При определении группы крови у новорожденного врачи учитывают, что антиген В полностью проявляется лишь к концу первого года жизни. Таким образом, ребенок с третьей группой крови может при рождении получить в медицинские документы первую, а с четвертой — вторую. По мере взросления ребенка это недоразумение обычно устраняется.

Зачем нужен резус-фактор

Кроме группы, кровь определяется и таким важным признаком, как резус-фактор (Rh). Он может быть положительным или отрицательным и обозначается, соответственно, знаками (+) и (-). Резус-фактор зависит от наличия или отсутствия антигена D на поверхности эритроцитов. Назначение этого антигена до сих пор до конца не установлено, однако известно, что 85% населения Земли — резус-положительны. Несовпадение резус-фактора при беременности или переливании крови может привести к тяжким последствиям, так как соприкосновение крови с разными значениями Rh начинают вырабатываться антитела.

Фото: РИА Новости/Георгий Зимарев

Однако опасна лишь ситуация, при которой резус-отрицательная мать вынашивает резус-положительного ребенка. При обратном соотношении резус-конфликта не происходит. Наибольшая опасность возникает в ситуации, когда резус-отрицательными являются оба родителя. В любом случае паре, задумывающейся о продолжении рода, всегда необходимо обратиться к медикам для консультации.

поиск лекарств, цены и наличие препаратов в аптеках null и Украины

О проекте – Моя Аптека

Моя Аптека – это самый быстрый и удобный способ найти необходимые лекарственные средства в любой аптеке на территории всей Украины. Мы предоставляем актуальную информацию о ценах и наличии лекарств в аптеках Украины. Здесь вы сможете приобрести лекарства по низким ценам, проведя сравнение стоимости или оформив резервирование в онлайн режиме.

В нашей базе собраны данные о более чем 11 000 000 товарных предложений медикаментов и сопутствующих товаров в 3000 аптечных точках Киева и других населенных пунктах Украины.

Обновление базы данных ассортимента товаров каждые 20 минут позволяет всегда предоставлять самую актуальную и достоверную информацию о медикаментах.

Кроме этого, пользователь может ознакомиться с графиком работы и контактами каждой аптечной точки, представленной на нашем ресурсе, найти адреса круглосуточных аптек 24 часа и построить к ним маршрут на карте.

Целью данного проекта является предоставление возможности каждому пользователю осуществлять поиск медикаментов максимально просто и эффективно, а заказать таблетки онлайн – быстро и удобно.

Преимущества для пользователей

Моя Аптека обладает рядом преимуществ, которые выгодно отличают нас от конкурентов, благодаря чему клиенты выбирают именно нас.

Мы предлагаем:

  • Возможность осуществить быстрый поиск лекарств в аптеках Киева и других городов Украины;
  • Узнать о наличии лекарства в аптеках Украины;
  • Посмотреть актуальные цена на лекарственные препараты в различных аптеках;
  • Осуществить сравнение цен в аптеках на интересующий препарат и узнать где его можно приобрести максимально выгодно;
  • Предоставляем возможность получить дополнительную скидку, при заказе лекарств онлайн;
  • Найти аналоги дорогих лекарств, сравнив лекарства по действующему веществу;
  • Ознакомиться с инструкцией по применению от изготовителя;
  • Узнать о наличии лекарств в ближайших аптеках, и самостоятельно построить маршрут на карте в онлайн режиме;
  • На нашем сайте вы сможете узнать точный адрес, контактные номера и график работы любой аптеки и найти ближайших к вам аптечный пункт.
  • Ознакомиться с полезными публикациями о здоровье, узнать последние новости из области медицины;
  • Поделиться своим отзывом о качестве обслуживания того или иного аптечного пункта;

Заказ и поиск лекарств в аптеках на сайте

На главной странице сайта находится строка для быстрого поиска необходимых медикаментов. По полному названию или его фрагменту ресурс предложит вам список найденных препаратов с актуальными ценами. Чтобы приобрести препарат по самой низкой стоимости, нужно просто сравнить цены в аптеках или оформить на него резерв для получения дополнительной скидки.

Использование фильтров по цене, расстоянию, графику работы сделают результаты вашего поиска более целевым и полезными.

Функционал сервиса будет полезен не только обычным пользователям, но и сотрудникам медицинских учреждений. На страницах расширенного поиска доступен подбор медикаментов по специализированным показателям:

О каждом лекарственном препарате на сайте размещена оригинальная инструкция по применению от производителя, в которой указано все о продукте: действующие вещества, назначение, противопоказания и побочные реакции. Перед покупкой следует тщательно ознакомиться с этой информацией. На этой же странице можно быстро найти аналоги лекарств, просто нажав кнопку Аналоги. Здесь вы увидите все варианты, которыми можно заменить интересующий препарат. А, чтобы заказать таблетки онлайн, необходимо нажать на зеленую кнопку рядом с ценой.

УВАЖАЕМЫЙ ПОЛЬЗОВАТЕЛЬ!
АДМИНИСТРАЦИЯ СЕРВИСА «МОЯ АПТЕКА» ПРЕДУПРЕЖДАЕТ: САМОЛЕЧЕНИЕ МОЖЕТ БЫТЬ ОПАСНЫМ ДЛЯ ВАШЕГО ЗДОРОВЬЯ! ИНФОРМАЦИЯ НА ДАННОМ РЕСУРСЕ ПРЕДСТАВЛЕНА ИСКЛЮЧИТЕЛЬНО В ОЗНАКОМИТЕЛЬНЫХ ЦЕЛЯХ И НЕ МОЖЕТ ЗАМЕНИТЬ КОНСУЛЬТАЦИЮ ВРАЧА.

Секреты человеческого организма: интересные факты о крови

В теле взрослого человека содержится в среднем 6-8% крови от общей массы. Правда, среднее количество крови в теле ребенка чуть больше и составляет 8-9%. Кровь движется по человеческому организму с разной скоростью. Быстрее всего она течет по артериям – 1,8 км в час. Кровь состоит из межклеточного вещества – плазмы и клеток крови (эритроцитов, лейкоцитов и тромбоцитов). Причем каждому типу кровяных клеток присущи определенные функции, пишет krugosvet.ru.

Так, например, эритроциты иначе называют красными кровяными тельцами, так как в них содержится гемоглобин, который придает крови красный цвет. Гемоглобин обеспечивает выполнение главной функции эритроцитов – транспорт газов, в частности кислорода. Красные кровяные тельца имеют форму двояковогнутых дисков, поэтому многие говорят, что они напоминают форму пончика без дырки. Эритроциты циркулируют в крови 120 дней, а затем разрушаются в печени и селезенке.

Тромбоциты – бесцветные тельца овальной или палочкообразной формы, они играют ключевую роль в процессе свертывания крови и защищают организм от значительных потерь крови при порезах и ранениях. Продолжительность их жизни гораздо меньше, чем эритроцитов, — всего 8-10 дней.

Белые клетки крови или лейкоциты – часть иммунной системы организма. Основная их функция — защитная. Они участвуют в иммунных реакциях и являются главными «борцами» с вирусами и вредными веществами. В норме лейкоцитов в крови намного меньше, чем других элементов. Если же их количество превышает заданные показатели, то это означает, что в организм попала инфекция. Продолжительность жизни лейкоцитов различна: от нескольких часов и суток до нескольких лет.

«Группа крови на рукаве»

Ни для кого не секрет, что всего существует четыре группы крови. Они были открыты в начале 20 века австрийским ученым Карлом Ландштайнером, за что в 1930 году ему была присуждена Нобелевская премия в области физиологии и медицины. А в 1940 г. Ландштайнер вместе с другими учеными Винером и Левайном открыли «резус-фактор».

Принадлежность к определённой группе крови не изменяется на протяжении жизни. Хотя науке известен один факт изменения группы крови. Этот случай произошел с австралийской девочкой Деми-Ли Бреннан. После операции по пересадке печени ее резус-фактор сменился с отрицательного на положительный. Это событие взбудоражило общественность, в том числе врачей и ученых.

Существует несколько делений человеческой крови на группы, но наибольшее значение имеет разделение крови на четыре группы по системе «AB0» и на две группы — по системе «резус». Четыре группы крови обозначаются символами: I(0), II(A), III(B), IV(AB).  Так, группа крови I(0) самая распространенная – она встречается у 45% людей на Земле. II(A) группа крови преобладает среди европейцев – ее носителями являются около 35% людей. III(B) группа крови менее многочисленная – ее можно встретить лишь у 13% людей. Самой редкой группой крови является IV(AB) – встречается лишь у 7% людей.

Некоторые ученые придерживаются довольно интересного мнения. Они считают, что судьба человека напрямую зависит от группы крови. В мире проводится множество исследований на эту тему. В Японии, например, считается, что кровь в большей степени определяет характер и особенности человека, чем знаки зодиака. Как сообщает vanicon.ru, проведение анализов и учет группы крови в Японии называют «кецу-еки-гата».

Японцы уверены, что обладатели I группы крови – люди общительные, эмоциональные и энергичные. Люди со II группой крови более стрессоустойчивы, терпеливы, любят гармонию и порядок, однако несколько упрямы. Впечатлительными, требовательными, властными и творческими личностями считаются люди с III группой кровы. Люди с редкой IV группой в жизни руководствуются чувствами, уравновешенны, нерешительны и резки.

«Кровавая» диета

Некоторые видят зависимость между группой крови и рационом питания. Например, обладателям самой древней группы крови (I) рекомендуется придерживаться высокопротеиновой диеты – есть мясо (кроме свинины), рыбу и морепродукты. Овощи и фрукты полезны любые, кроме кислых. Лучше избегать в рационе пшеницу и пшеничные изделия, кукурузу, сообщает abc-your-health.com.

А вот люди со II-й группой крови склонны к онкологическим заболеваниям, анемии, заболеваниям сердца, печени и желудка. Им рекомендуется придерживаться вегетарианской диеты – ограничить употребление молочных продуктов, заменить их соевыми, употреблять крупы, фрукты и рыбу.

Считается, что у людей с III-й группой крови при неправильной диете появляется неустойчивость к редким вирусным заболеваниям, синдром хронической усталости. Поэтому им рекомендуется придерживаться сбалансированной диеты – есть мясо (кроме птицы), яйца, крупы, овощи (кроме кукурузы, помидоров), фрукты. Не советуют употреблять морепродукты.

Самая «молодая» группа крови – IV, ее обладателям не советуют увлекаться морепродуктами, орехами, крупами, овощами и некислыми фруктами.

Материал подготовлен интернет-редакцией www.rian.ru на основе информации открытых источников.

6.5 Вариации групп крови — Биология человека

Создал: CK-12 / Адаптировал Кристин Миллер

Рисунок 6.5.1 Флеботомист берет кровь у донора.

Вы когда-нибудь сдавали кровь? Если да, то вы, вероятно, знаете, что ваша группа крови является важным фактором при переливании крови. Люди различаются по типу крови, которую они наследуют, и это определяет, какой тип крови они могут безопасно получить при переливании. Знаете ли вы свою группу крови?

Кровь состоит из клеток, взвешенных в жидкости, называемой плазмой.В крови есть три типа клеток: красные кровяные тельца, переносящие кислород; лейкоциты, которые борются с инфекциями и другими угрозами; и тромбоциты — фрагменты клеток, которые способствуют свертыванию крови. Группа крови (или группа крови) — это генетическая характеристика, связанная с присутствием или отсутствием определенных молекул, называемых антигенами, на поверхности эритроцитов. Эти молекулы могут помочь поддерживать целостность клеточной мембраны, действовать как рецепторы или выполнять другие биологические функции.Система группы крови относится ко всем генам, аллелям и возможным генотипам и фенотипам, которые существуют для определенного набора антигенов группы крови. Системы групп крови человека включают хорошо известные системы ABO и резус (Rh), а также по меньшей мере 33 других, менее известных.

Антигены и антитела

Антигены , такие как те, что находятся в красных кровяных тельцах — это молекулы, которые иммунная система определяет как собственные (производимые вашим собственным телом) или чужие (не производимые вашим собственным телом).Антигенами группы крови могут быть белки, углеводы, гликопротеины (белки, прикрепленные к цепочкам сахаров) или гликолипиды (липиды, прикрепленные к цепочкам сахаров), в зависимости от конкретной системы группы крови. Если антигены идентифицированы как чужие, иммунная система отвечает образованием антител, специфичных к чужеродным антигенам. Антитела — это большие Y-образные белки, продуцируемые иммунной системой, которые распознают и связываются с чужеродными антигенами. Аналогия замка и ключа часто используется для представления того, как антитело и антиген сочетаются друг с другом, как показано на иллюстрации ниже (Рисунок 6.5.2). Когда антитела связываются с антигенами, они помечают их для разрушения другими клетками иммунной системы. Несамоантигены могут попадать в ваш организм с патогенами (такими как бактерии или вирусы), с пищевыми продуктами или с эритроцитами при переливании крови от человека с группой крови, отличной от вашей. Последний способ в настоящее время практически невозможен из-за эффективных протоколов определения группы крови и скрининга.

Рисунок 6.5.2 Модель антигена и подходящего антитела. Антитела будут обнаруживать антигены на основе совпадения в трехмерной форме в соответствии с моделью замка и ключа.

Генетика группы крови

Группа крови человека зависит от того, какие аллели системы группы крови унаследованы от родителей. Обычно группа крови контролируется аллелями одного гена или двух или более очень тесно связанных генов. Тесно сцепленные гены почти всегда наследуются вместе, потому что рекомбинация между ними незначительна или отсутствует. Как и другие генетические особенности, группа крови человека обычно фиксируется на всю жизнь, но в редких случаях группа крови может измениться.Это может произойти, например, если человеку сделают трансплантацию костного мозга для лечения заболевания, такого как лейкемия. Если костный мозг поступает от донора с другой группой крови, группа крови пациента может в конечном итоге преобразоваться в группу крови донора, поскольку красные кровяные тельца производятся в костном мозге.

Система групп крови ABO — самая известная система групп крови человека. Антигенами в этой системе являются гликопротеины. Эти антигены показаны в списке ниже.Для системы ABO существует четыре распространенных группы крови:

.
  1. Тип A, в котором присутствует только антиген A.
  2. Тип B, в котором присутствует только антиген B.
  3. Тип AB, в котором присутствуют как антигены A, так и B.
  4. Тип O, в котором нет ни антигена A, ни B.

Генетика системы ABO

Система групп крови ABO контролируется одним геном на хромосоме 9. Существует три общих аллеля для этого гена, которые часто обозначаются буквами A, B и O.При трех аллелях существует шесть возможных генотипов группы крови ABO. Однако аллели А и В оба доминантны по отношению к аллелю О и кодоминантны друг другу. В результате получается всего четыре возможных фенотипа (группы крови) для системы ABO. Эти генотипы и фенотипы показаны в таблице 6.5.1.

Таблица 6.5.1

Система групп крови ABO: генотипы и фенотипы

Система групп крови ABO
Генотип Фенотип (группа крови)
AA А
АО А
BB B
BO B
OO O
AB AB

На схеме ниже (Рисунок 6.5.3) показан пример того, как наследуется группа крови ABO. В этом конкретном примере отец имеет группу крови A (генотип АО), а мать — группу крови B (генотип BO). Этот тип спаривания может производить детей с каждым из четырех возможных фенотипов ABO, хотя в любой данной семье не все фенотипы могут присутствовать у детей.

Рисунок 6.5.3 Пример наследования группы крови ABO.

Медицинское значение группы крови ABO

Система ABO — самая важная система группы крови при переливании крови.Если эритроциты, содержащие определенный антиген ABO, переливаются человеку, у которого отсутствует этот антиген, иммунная система человека распознает антиген в эритроцитах как чужеродный. Антитела, специфичные к этому антигену, атакуют эритроциты, заставляя их агглютинировать (или слипаться) и распадаться. Если пациенту случайно переливают несовместимую кровь, может возникнуть тяжелая реакция (называемая острой гемолитической трансфузионной реакцией), при которой многие эритроциты разрушаются.Это может привести к почечной недостаточности, шоку и даже смерти. К счастью, сегодня таких несчастных случаев со здоровьем практически не бывает.

Эти антитела часто спонтанно вырабатываются в первые годы жизни после контакта с обычными микроорганизмами в окружающей среде, имеющими антигены, сходные с антигенами крови. В частности, человек с кровью типа A будет вырабатывать антитела против B, в то время как человек с кровью типа B будет вырабатывать антитела против A. Человек с кровью типа AB не вырабатывает ни одного антитела, в то время как человек с кровью типа O вырабатывает как анти-A, так и анти-B антитела.После выработки антител они циркулируют в плазме. Взаимосвязь между антигенами эритроцитов ABO и антителами плазмы показана на рисунке 6.5.4.

Рисунок 6.5.4 Взаимосвязь между антигенами эритроцитов ABO и антителами плазмы.

Циркулирующие в плазме антитела относятся к антигенам, отличным от антигенов красных кровяных телец, которые распознаются как аутоантигены.

Рисунок 6.5.5 Вы всегда можете сдать кровь человеку с той же группой крови, что и ваша, но вы можете или не сможете сдать кровь людям с другой группой крови, как показано на этой диаграмме.

Какие группы крови совместимы, а какие нет? Кровь типа O содержит как анти-A, так и анти-B антитела, поэтому люди с кровью типа O могут получать только кровь типа O. Однако они могут сдать крови людям с любой группой крови ABO, поэтому людей с кровью типа O называют универсальными донорами. Кровь типа AB не содержит ни анти-A, ни анти-B антител, поэтому люди с кровью типа AB могут получать кровь от людей с любой группой крови ABO.Вот почему людей с кровью типа AB называют универсальными реципиентами. Они могут сдавать кровь, однако только людям, у которых также есть кровь типа AB. Эти и другие взаимосвязи между группами крови доноров и реципиентов показаны на простой диаграмме справа.

Географическое распределение групп крови ABO

Частоты групп крови для системы ABO различаются по всему миру. Вы можете увидеть, как аллели A и B и группа крови O распределены географически на картах на Рисунке 6.5.6.

  • Во всем мире B — самый редкий аллель ABO, поэтому кровь группы B — наименее распространенная группа крови ABO. Только около 16 процентов всех людей имеют аллель B. Его самая высокая частота — в Азии. Самая низкая частота встречается у коренных жителей Австралии и Америки.
  • Аллель A несколько более распространен во всем мире, чем аллель B, поэтому кровь типа A также более распространена, чем кровь типа B. Самые высокие частоты аллеля А наблюдаются у австралийских аборигенов, саамов в Северной Скандинавии и коренных американцев племени черноногих в Северной Америке.Аллель почти отсутствует у коренных американцев в Центральной и Южной Америке.
  • Аллель O является наиболее распространенным аллелем ABO во всем мире, а кровь группы O — наиболее распространенной группой крови ABO. Почти две трети людей имеют хотя бы одну копию аллеля О. Это особенно распространено у коренных американцев в Центральной и Южной Америке, где частота достигает 100 процентов. Он также имеет относительно высокие частоты у австралийских аборигенов и западных европейцев. Его частоты самые низкие в Восточной Европе и Центральной Азии.

Рисунок 6.5.6 Карты популяций с аллелями A, B и O.

Эволюция системы групп крови ABO

Географическое распределение аллелей группы крови ABO косвенно свидетельствует об эволюционной истории этих аллелей. Эволюционные биологи предполагают, что сначала возник аллель группы крови A, затем аллель группы крови O, а затем аллель группы крови B. Эта хронология учитывает процентное соотношение людей во всем мире с каждой группой крови, а также согласуется с ней. с известными моделями ранних перемещений населения.

Эволюционные силы эффекта основателя и генетического дрейфа, несомненно, сыграли значительную роль в нынешнем распределении групп крови ABO во всем мире. Географические вариации групп крови ABO также могут зависеть от естественного отбора, поскольку считается, что разные группы крови различаются по своей восприимчивости к определенным заболеваниям. Например:

  • Люди с кровью типа O могут быть более восприимчивыми к холере и чуме. У них также чаще развиваются язвы желудочно-кишечного тракта.
  • Люди с кровью типа А могут быть более восприимчивыми к оспе и с большей вероятностью заболеть некоторыми видами рака.
  • У людей с кровью типов A, B и AB менее вероятно образование тромбов, которые могут вызвать инсульт. Однако в начале нашей истории способность крови образовывать сгустки — которая проявляется в большей степени у людей с кровью типа O — могла быть преимуществом для выживания.
  • Возможно, самая большая естественная селективная сила, связанная с группами крови ABO, — это малярия. Имеются убедительные доказательства того, что люди с кровью типа O в некоторой степени устойчивы к малярии, что дает им избирательное преимущество там, где малярия является эндемической.

Другая хорошо известная система групп крови — это резус (Rh) система группы крови . Система резус имеет десятки различных антигенов, но только пять основных антигенов (называемых D, C, c, E и e). Основным антигеном резуса является антиген D. Людей с антигеном D называют резус-положительными (Rh +), а людей, у которых отсутствует антиген D, называют резус-отрицательными (Rh-). Считается, что резус-антигены играют роль в транспортировке ионов через клеточные мембраны, действуя как канальные белки.

Система групп крови резус контролируется двумя сцепленными генами на хромосоме 1. Один ген, называемый RHD, продуцирует единственный антиген, антиген D. Другой ген, называемый RHCE, продуцирует другие четыре относительно общих антигена резуса (C, c, E и e), в зависимости от того, какие аллели этого гена передаются по наследству.

Группа крови резус и переливание крови

После системы ABO, резус-система является второй по важности системой групп крови при переливании крови. Антиген D с наибольшей вероятностью вызывает иммунный ответ у людей, у которых этот антиген отсутствует.Людям с антигеном D (Rh +) можно безопасно переливать кровь Rh + или Rh-, тогда как людям, у которых отсутствует антиген D (Rh-), можно безопасно переливать только кровь Rh-.

В отличие от антител анти-A и анти-B к антигенам ABO, антитела анти-D для системы резус обычно не образуются путем сенсибилизации к веществам окружающей среды. Однако люди, у которых отсутствует антиген D (Rh-), могут вырабатывать анти-D антитела при контакте с Rh + кровью. Это может произойти случайно при переливании крови, хотя сегодня это крайне маловероятно.Это также может произойти во время беременности с Rh + плодом, если некоторые из клеток крови плода попадают в кровоток матери.

Гемолитическая болезнь новорожденных

Если женщина с резус-фактором- вынашивает плод с резус-фактором, он может подвергаться риску. Это особенно вероятно, если у матери образовались антитела к D во время предыдущей беременности из-за смешивания крови матери и плода во время родов. В отличие от антител против антигенов ABO, антитела против антигена резуса D могут проникать через плаценту и попадать в кровь плода.Это может вызвать гемолитическую болезнь новорожденных (HDN) , также называемую эритробластозом плода, заболевание, при котором эритроциты плода разрушаются материнскими антителами, вызывая анемию. Эта болезнь может варьироваться от легкой до тяжелой. В тяжелых случаях это может привести к повреждению головного мозга и иногда к летальному исходу для плода или новорожденного. К счастью, HDN можно предотвратить, предотвратив образование анти-D антител в Rh-матери. Это достигается путем введения матери лекарственного препарата под названием иммуноглобулин Rho (D).

Географическое распространение резус-групп крови

Большинство людей во всем мире имеют резус +, но существуют региональные различия в этой системе групп крови, как и в системе ABO. Первоначально у коренных жителей Америки и Австралии был очень близкий к 100% резус + кровь. Частота группы крови Rh + также очень высока в африканских популяциях — от 97 до 99 процентов. В Восточной Азии частота Rh + немного ниже, примерно от 93 до 99 процентов.У европейцев самая низкая частота группы крови Rh + — от 83 до 85 процентов.

Чем объясняется популяционная изменчивость резус-групп крови? До появления современной медицины резус-положительные дети, зачатые резус-женщинами, были подвержены риску гибели плода или новорожденного или повреждения от ГБН. Это было загадкой, потому что, по-видимому, естественный отбор сработает, чтобы удалить более редкого фенотипа (Rh-) из популяций. Однако частота этого фенотипа относительно высока во многих популяциях.

Недавние исследования обнаружили доказательства того, что естественный отбор может фактически благоприятствовать гетерозиготам по антигену резуса D. Селективным агентом в этом случае считается токсоплазмоз , — паразитарное заболевание, вызываемое простейшими Toxoplasma gondii, , которые очень распространены во всем мире. Вы можете увидеть диаграмму жизненного цикла паразита на рис. 6.5.7. Заражение этим паразитом часто не вызывает никаких симптомов или может вызывать симптомы гриппа в течение нескольких дней или недель.Однако контакт с паразитом был связан с повышенным риском психических расстройств (таких как шизофрения), неврологических расстройств (таких как болезнь Альцгеймера) и других неврологических проблем, включая замедленное время реакции. Одно исследование показало, что люди с положительным результатом теста на антитела к паразиту более чем в два раза чаще попадают в дорожно-транспортные происшествия.

Рисунок 6.5.7 Токсоплазмоз (toxoplasma gondii): инфекционная и диагностическая стадии.

У людей, гетерозиготных по антигену D, менее вероятно развитие негативных неврологических и психических эффектов инфекции Toxoplasma gondii .Это могло бы помочь объяснить, почему оба фенотипа (Rh + и Rh-) поддерживаются в большинстве популяций. Существуют также поразительные географические различия в распространенности токсоплазмоза во всем мире: от нуля до 95 процентов в разных регионах. Это могло бы объяснить географические различия в антигене D во всем мире, потому что его сила как селективного агента будет варьироваться в зависимости от его распространенности.

Миф

Реальность

«Ваши потребности в питании можно определить по группе крови ABO.Зная свою группу крови, вы можете выбрать подходящую пищу, которая поможет вам похудеть, повысить вашу энергию и прожить более долгую и здоровую жизнь ». Эта идея была предложена в 1996 году в бестселлере New York Times Eat Right for Your Type натуропатом Питером Д’Адамо. Натуропатия — это метод лечения заболеваний, который включает использование трав, солнечного света, свежего воздуха и других природных веществ. Некоторые врачи считают натуропатию лженаукой.В крупном научном обзоре диеты по группе крови не было обнаружено никаких доказательств, подтверждающих это. В одном исследовании взрослые, соблюдающие диету, предназначенную для группы крови А, показали улучшение здоровья, но это произошло у всех, независимо от их группы крови. Поскольку диета по группе крови основана исключительно на группе крови, она не учитывает другие факторы, которые могут потребовать корректировок или ограничений диеты. Например, люди с диабетом — но с разными группами крови — будут придерживаться разных диет, и одна или обе диеты могут противоречить стандартным диетическим рекомендациям при диабете и быть опасными.
«Группа крови ABO связана с определенными личностными качествами. Например, люди с группой крови A терпеливы и ответственны, но также могут быть упрямыми и напряженными, тогда как люди с группой крови B энергичны и креативны, но также могут быть безответственными и беспощадными. При выборе супруга следует принимать во внимание как вашу собственную группу крови, так и группу крови вашего потенциального партнера, чтобы обеспечить совместимость ваших личностей ». Вера в то, что группа крови коррелирует с личностью, широко распространена в Японии и других странах Восточной Азии.Идея была первоначально представлена ​​в 1920-х годах в исследовании, проведенном по заказу правительства Японии, но позже было показано, что она не имеет научной поддержки. Эта идея была возрождена в 1970-х годах японским телеведущим, написавшим об этом популярные книги. У этой идеи нет научного обоснования, и она обычно отвергается научным сообществом как псевдонаука. Тем не менее, он остается популярным в странах Восточной Азии, так же как астрология популярна во многих других странах.

  • Группа крови (или группа крови) — это генетическая характеристика, связанная с наличием или отсутствием антигенов на поверхности эритроцитов.Система группы крови относится ко всем генам, аллелям и возможным генотипам и фенотипам, которые существуют для определенного набора антигенов группы крови.
  • Антигены — это молекулы, которые иммунная система определяет как собственные или чужие. Если антигены идентифицируются как чужие, иммунная система отвечает образованием антител, специфичных к чужеродным антигенам, что приводит к разрушению клеток, несущих антигены.
  • Система групп крови ABO — это система антигенов эритроцитов, контролируемая одним геном с тремя общими аллелями на хромосоме 9.Существует четыре возможных типа крови ABO: A, B, AB и O. Система ABO является наиболее важной системой групп крови при переливании крови. Люди с кровью типа O являются универсальными донорами, а люди с кровью группы AB — универсальными реципиентами.
  • Частоты аллелей группы крови ABO и групп крови различаются по всему миру. Аллель антигена B встречается реже, а группа крови O является наиболее распространенной. Эволюционные силы эффекта основателя, генетического дрейфа и естественного отбора ответственны за географическое распределение аллелей ABO и групп крови.Например, люди с кровью типа O могут быть в некоторой степени устойчивыми к малярии, что может дать им избирательное преимущество там, где малярия является эндемической.
  • Система групп крови резус — это система антигенов эритроцитов, контролируемая двумя генами с множеством аллелей на хромосоме 1. Существует пять общих антигенов резуса, из которых антиген D является наиболее значимым. Людей, у которых есть антиген D, называют Rh +, а людей, у которых нет антигена D, называют Rh-. Rh- матери Rh + плодов могут продуцировать антитела против антигена D в крови плода, вызывая гемолитическую болезнь новорожденных (HDN).
  • Большинство людей во всем мире имеют резус +, но существуют региональные различия в системе групп крови. Эта вариация может быть объяснена естественным отбором, который отдает предпочтение гетерозиготам по антигену D, поскольку этот генотип, по-видимому, защищен от некоторых неврологических последствий токсоплазмоза, вызываемого общей паразитарной инфекцией.
  1. Определите группу крови и систему группы крови.
  2. Объясните взаимосвязь между антигенами и антителами.
  3. Определите аллели, генотипы и фенотипы в системе групп крови ABO.
  4. Обсудите медицинское значение системы групп крови ABO.
  5. Сравните относительные частоты трех аллелей ABO во всем мире.
  6. Приведите примеры того, как разные группы крови ABO различаются по восприимчивости к заболеваниям.
  7. Опишите систему групп крови резус.
  8. Связать группы крови резус с переливаниями крови.
  9. Что вызывает гемолитическую болезнь новорожденного?
  10. Опишите, как токсоплазмоз может объяснить сохранение резус-группы крови в человеческих популяциях.
  11. Женщина имеет группу крови O и Rh-, а ее муж — группу крови AB и Rh +. Ответьте на следующие вопросы об этой паре и их потомстве.
    1. Каковы возможные генотипы их потомков по группе крови ABO?
    2. Каковы возможные фенотипы их потомков с точки зрения группы крови ABO?
    3. Может ли женщина сдать кровь мужу? Поясните свой ответ.
    4. Может ли мужчина сдать кровь жене? Поясните свой ответ.
  12. Кровь типа O характеризуется наличием антигенов O — объясните, почему это утверждение неверно.
  13. Объясните, почему гемолитическая болезнь новорожденных с большей вероятностью может возникнуть при второй беременности, чем при первой.

Почему важны группы крови? — Натали С. Ходж, TED-Ed, 2015.

.

Как работает переливание крови? — Билл Шутт, TED-Ed, 2020.

.

Атрибуты

Рисунок 6.5.1

По следам донорства крови, автор EJ Hersom / Министерство обороны США находится в открытом доступе.[Заявление об ограничении ответственности: появление визуальной информации Министерства обороны США не означает одобрения Министерства обороны США.]

Рисунок 6.5.2

Антитело

от Fvasconcellos на Wikimedia Commons опубликовано в открытом доступе (https://en.wikipedia.org/wiki/Public_domain).

Рисунок 6.5.3

Система ABO codominance.svg, адаптированная Яссином Мрабетом (исходное изображение «Кодоминант» из Национальной медицинской библиотеки США) на Wikimedia Commons находится в общественном достоянии (https: // en.wikipedia.org/wiki/Public_domain) .

Рисунок 6.5.4

ABO_blood_type.svg от InvictaHOG на Wikimedia Commons передано в общественное достояние (https://en.wikipedia.org/wiki/Public_domain) .

Рисунок 6.5.5

НПА донора и получателя крови от CK-12 Foundation используется в соответствии с лицензией CC BY-NC 3.0 (https://creativecommons.org/licenses/by-nc/3.0/).

Рисунок 6.5.6

Рисунок 6.5,7

Toxoplasma_gondii_Life_cycle_PHIL_3421_lores, автор — Александр Дж. Да Силва, доктор философии / Мелани Мозер, Библиотека изображений общественного здравоохранения Центров по контролю и профилактике заболеваний (PHIL # 3421 ) на Wikimedia Commons находится в открытом доступе (https: //en.wikipedia. org / wiki / Public_domain).

Таблица 6.5.1

Система групп крови ABO: генотипы и фенотипы была создана Кристин Миллер.

Список литературы

Дин, Л.(2005). Глава 4 Гемолитическая болезнь новорожденных. В группах крови и антигенах красных клеток [Интернет]. Национальный центр биотехнологической информации (США). https://www.ncbi.nlm.nih.gov/books/NBK2266/

Персонал клиники Мэйо. (нет данных). Токсоплазмоз [онлайн-статья]. MayoClinic.org. https://www.mayoclinic.org/diseases-conditions/toxoplasmosis/symptoms-causes/syc-20356249

MedlinePlus. (2019, 29 января). Гемолитическая трансфузионная реакция [онлайн-статья]. Национальная медицинская библиотека США.https://en.wikipedia.org/w/index.php?title=Chromosome_9&oldid=946440619

TED-Ed. (2015, 29 июня). Почему важны группы крови? — Натали С. Ходж. YouTube. https://www.youtube.com/watch?v=xfZhb6lmxjk&feature=youtu.be

TED-Ed. (2020, 18 февраля). Как работают переливания крови? — Билл Шутт. YouTube. https://www.youtube.com/watch?v=qcZKbjYyOfE&feature=youtu.be

авторов Википедии. (2020, 10 мая). Хромосома 1. В Википедии . https: // en.wikipedia.org/w/index.php?title=Chromosome_1&oldid=955942444

авторов Википедии. (2020, 20 марта). Хромосома 9. В Википедии . https://en.wikipedia.org/w/index.php?title=Chromosome_9&oldid=946440619

Группа крови | Память Alpha

Множественные реальности
(охватывает информацию из нескольких альтернативных графиков времени)

Группа крови была характеристикой клеток крови, определяемой наличием специфических поверхностных антигенов.Знание этих типов необходимо при переливании крови.

У людей красные кровяные тельца определяют группы крови (которые обычно использовали две системы для определения переливаний крови: обозначение ABO и обозначение резус-фактора). Всего существует восемь групп крови Человека: O +, A +, B +, AB +, O−, A−, B− и AB−. (ЛОР: «Карпентер-стрит»)

Вулканцы использовали аналогичную номенклатуру для определения групп крови, поскольку у Спока и Сарека была Т-отрицательная кровь. Это был редкий тип даже для вулканца.(TOS: «Путешествие в Вавилон»)

Доктор Флокс обнаружил, что легко синтезировать группу крови Бурзаана для переливания после того, как Эска подверглась нападению драйвжина. (ЛОР: «Планета изгоев»)

Выполняя мошенническую миссию по уничтожению человечества, Дамрон и небольшая группа зинди-рептилоидов отправились назад во времени на Землю в 2004 году, где они попытались использовать биореактор для синтеза вируса для своего биологического оружия. Биооружие требовало, чтобы образцы всех восьми типов человеческой крови были правильно откалиброваны.Рептилии наняли человека по имени Лумис, чтобы получить для них образцы всех этих групп крови. Этот план, однако, был раскрыт Дэниелсом Джонатану Арчеру, и он и Т’Пол также были отправлены в Детройт в 2004 году, чтобы остановить рептилоидов. К моменту своего прибытия рептилии « модифицировали вирус только для шести [из восьми человеческих] групп крови, », прежде чем они были остановлены. Согласно Т’Пол, даже с шестью группами крови рептилоиды могли бы « заразить три четверти населения Земли, » и, как таковые, означало бы, что « маловероятно, что люди [будут] представлять угрозу для их в будущем. «(ЛОР:» Карпентер-стрит «)

В 2267 году, не понимая, почему Павел Чехов не стареет, как остальные участники десантной группы Гамма Гидра IV, Джеймс Т. Кирк вслух задавался вопросом, было ли это « его молодость, его группа крови, его происхождение, его железы. , его гены? «(TOS:» Смертельные годы «)

Керзон Дакс и Джадзия Дакс имели разные группы крови. В 2369 году Башир процитировал это как доказательство того, насколько разные Триллы отличаются друг от друга, несмотря на то, что они несут в себе воспоминания других.(DS9: «Дакс»)

Внешние ссылки

Есть ли у приматов группа крови, аналогичная человеческой? ›Спросите эксперта (ABC Science)

Люди многим обязаны макаке-резус.

Эта маленькая обезьянка рассказала о космических путешествиях, клонировании и поведении человека.

Но, пожалуй, самое главное, он первым предупредил ученых о существовании знаменитого «резус-фактора» в крови человека, молекулы, которая либо присутствует (Rh +), либо отсутствует (Rh-) в наших красных кровяных тельцах, — говорит доктор Брюс Райдаут из Сан-Франциско. Институт природоохранных исследований зоопарка Диего.

Rh обозначает макаки-резус, потому что исследователи установили, что этот антиген крови человека был похож на антиген крови макаки-резуса.

Типы крови были изучены только у нескольких видов приматов, но Ридаут говорит, что обезьяны Старого Света и обезьяны имеют группы крови, сопоставимые, хотя и не идентичные, с системой групп крови АВО человека.

По данным Австралийского Красного Креста, существует более 270 антигенов крови человека, принадлежащих более чем к 30 системам групп крови.

Две основные системы групп крови, используемые при переливании, — это резус-фактор и система групп крови ABO.

Тип крови у нас определяется молекулами или антигенами на поверхности наших красных кровяных телец.

Например, в системе групп крови ABO у людей с группой крови A есть один тип молекулы, тогда как у людей с группой крови B — другой. У людей с группой крови AB есть обе молекулы на эритроцитах, а у людей с группой крови O молекулы этой группы отсутствуют.

Эти антигены также содержат соответствующие антитела в нашей плазме крови, чтобы определить, когда чужеродные антигены попадают в наш организм.

Люди с группой крови A имеют антитела против B, группа крови B имеет антитела против A, группа крови AB не имеет ни одного антитела, а группа крови O имеет оба.

Антигены и антитела становятся очень важными при подборе крови для переливания.

«Если вы не соответствуете группе крови донора и реципиента, иммунная система реципиента распознает перелитую кровь как инородного захватчика и уничтожит все перелитые клетки крови», — говорит Райдаут.

«O-кровь… обычно может быть перелита любому реципиенту, потому что в ней отсутствуют как молекулы A и B, так и резус-фактор, поэтому на поверхности перелитых клеток крови нет ничего важного, что иммунная система реципиента распознала бы как чужеродные, — говорит Rideout.

При правильном перекрестном сопоставлении теоретически можно было бы проводить переливание крови между близкородственными видами, такими как обезьяны и люди, — говорит Ридеут.

Но существует достаточно различий между системами ABO обезьяны и человека, которые могут повлиять на успех ксенотрансфузии.

Rideout говорит, что эти различия произошли потому, что как только предки человека и другие приматы стали репродуктивно изолированными друг от друга, гены, которые кодируют или регулируют присутствие молекул на поверхности красных кровяных телец, начали накапливать небольшие мутации и уходить.

Поскольку генетические мутации, произошедшие в одной популяции, не обязательно происходили в другой, со временем эти изменения накапливались.

Даже если бы мы смогли преодолеть этот эволюционный разрыв, большинство видов обезьян и приматов либо находятся под угрозой исчезновения, либо находятся под угрозой исчезновения.

Итак, в связи с сокращением запасов человеческой крови некоторые ученые предположили, что люди могут быть обязаны своей жизнью другому млекопитающему в будущем: свинье.

Но это уже другая история.

Сюзанна Лайонс взяла интервью у доктора Брюса Райдаута.

Новый метод оптического биосенсора для определения групп крови человека с использованием fre

Ebraheem Sultan, 1 Mariam Albahrani, 2 Jasem Alostad, 3 Hameed K Ebraheem, 1 Alatherbahmud49 1

1 Кафедра электронных инженерных технологий, Технологический колледж (CTS), Государственный орган прикладного образования и обучения (PAAET), Государство Кувейт; 2 Кафедра медицинских лабораторных исследований, Колледж смежных медицинских наук, Кувейтский университет, Государство Кувейт; 3 Департамент вычислительной техники, Колледж фундаментальных исследований, Государственный орган прикладного образования и обучения (PAAET), Шувайх, Государство Кувейт

Справочная информация: Широкополосная частотно-модулированная передача фотонов в ближнем инфракрасном (NIR) диапазоне в свободном пространстве и метод режима обратного рассеяния был использован в этой статье в качестве метода оптического биосенсора.
Цель: Цель — измерение, идентификация и извлечение оптических свойств различных групп крови.
Пациенты и методы: Метод зависит от измерений широкополосных частот в диапазоне от 30 до 1000 МГц для прогнозирования двух важных параметров, связанных с падающим модулированным сигналом. Слепые образцы, собранные у 30 пациентов, были исследованы с использованием системы оптического режима передачи NIR, и еще 40 образцов крови от случайных пациентов были исследованы с использованием системы режима оптического NIR отражения.Исследование разделено на два этапа. Первый этап посвящен измерению вносимых потерь и фазы вставки на частотах более 30–1000 МГц в режиме передачи для характеристики поведения модулированных фотонов при их взаимодействии с образцами крови. Второй этап посвящен выполнению неинвазивных измерений обратного рассеяния с использованием оптического диапазона, разработанного для согласования результатов первого этапа.
Результаты: В этой статье мы создали индексированную базу данных, используя измерения режима оптической передачи, а затем сопоставили ее с неинвазивным измерением отражения для определения групп крови.Затем с целью обеспечения точности устройства мы случайным образом выбрали 480 новых людей для измерения процента ложноотрицательных ошибок. Этот метод является новым с точки зрения использования оптической системы для измерения и идентификации групп крови без сбора образцов крови.
Заключение: Новый подход демонстрирует высокоточный метод мгновенного определения различных типов крови с использованием оптического зондирования как для процедур in vitro, так и in vivo, что позволяет экономить время и усилия.

Ключевые слова: fNIR-спектроскопия, VCSEL — оптический передатчик, APD — оптический приемник, фаза вставки, IP, вносимые потери, IL, определение группы крови ABO

Введение

Типичный способ типирования крови является инвазивным, требует много времени и может предложить меньшую, чем стандартизированную точность, из-за различий в технических специалистах или в лабораториях, где проводится тестирование.Учитывая эти недостатки, существует реальная потребность в использовании устройства для неинвазивного определения группы крови. В процедурах ручного определения группы крови, которые были традиционным аспектом медицины, не используются преимущества технологических достижений, интегрированных в отрасль здравоохранения, в том числе за счет использования носимых устройств для идентификации и мониторинга. 1 Международный научно-исследовательский журнал представил в 2016 году статью, в которой описывалось портативное устройство, разработанное международной группой исследователей, которое помещается на кончик пальца для подсчета лейкоцитов (лейкоцитов) без анализа крови.Эта технология сочетает в себе оптический датчик с алгоритмами для использования на пациентах, проходящих химиотерапию, что позволяет определять уровни иммунной системы в режиме реального времени. 2 Этот тип носимых устройств также полезен при обнаружении серьезных инфекций и включает портативную оптическую систему, которая обеспечивает наклонное освещение через светодиоды и захватывает изображения поверхностных капилляров под кожей с клеточным разрешением. В системе используется небольшая линза для получения изображения капилляров вблизи ногтевого ложа, и при освещении с определенной частотой можно увидеть только гемоглобин в красных кровяных тельцах (эритроцитах), поглощающий свет. 3 Носимые устройства — это те устройства, которые постоянно находятся у человека. Если бы мониторинг заболевания можно было сочетать с носимыми устройствами вместе с возможностью документирования в режиме реального времени в медицинских записях пациентов, это принесло бы пользу как лицам, осуществляющим уход, так и пациентам, сэкономив время, деньги, усилия и объем затрачиваемой работы. обеими сторонами в процессе оказания медицинской помощи, тем самым способствуя оказанию качественной медицинской помощи.

Клетки крови обычно содержат три компонента: эритроциты, лейкоциты и тромбоциты.Все три формализуют клетки крови в организме человека. Каждый компонент клеток крови имеет разные обязанности. Эритроциты переносят кислород по телу и удаляют углекислый газ и другие отходы. Лейкоциты являются частью иммунной системы, которая помогает бороться с инфекциями, а тромбоциты — это клетки, которые циркулируют в крови, чтобы предотвратить кровотечение путем свертывания. 4 Группы крови идентифицируются по антигенам и антителам. Антигены — это белки, расположенные на поверхности эритроцитов, а антитела — это белки, расположенные в плазме.Анализ крови обычно используется для медицинской диагностики и помогает в выявлении различных заболеваний. Антигены на эритроцитах определяют каждую отдельную группу крови и делят их на две основные группы, называемые ABO (с группами крови A, B, AB и O) и Rh (с Rh D-положительными или Rh D-отрицательными группами крови). Существует множество теорий относительно функциональности антигенов группы крови, но их цели не очень хорошо известны. 5 Типирование крови — это задача определения типа крови у человека, очень важная и распространенная процедура, которая является предпосылкой для различных гематологических переливаний.Тем не менее, сообщалось о различных смертельных случаях из-за ошибок при определении группы крови. 5 Причина этих смертельных случаев — механизм блокировки различных белков, присутствующих в крови человека, а именно антигенов и антител.

Определенная группа крови определяется на основании наличия или отсутствия различных типов этих белков. Если определенный тип антигена обнаруживает аналогичный тип антитела, он связывается с ним. В противном случае происходит гемолиз, что в худшем случае приводит к летальному исходу.Таким образом, переливание крови регулируется соответствием конкретных белков, определяемых каждой группой крови. Типирование крови основано на обнаружении антигенов на поверхности эритроцитов. 5,6 Существуют различные системы определения группы крови; тем не менее, группа крови по системе ABO является наиболее важной и распространенной. Для определения группы крови по системе ABO исследователи ввели различные методы. В клинических условиях идеальным методом является метод, требующий меньшего количества эритроцитов (наоборот, меньшее количество крови) и определение группы крови за довольно короткое время (то есть в течение нескольких минут.) Одним из таких методов является метод массива антител, основанный на визуализации поверхностного плазмонного резонанса (SPR). 7 SPR — это оптический метод в реальном времени, который позволяет количественно определять адсорбцию на поверхности материала, то есть антигены, адсорбированные на поверхности эритроцитов. В нем используется многоканальная проточная ячейка тепловизора SPR. 7 Пятистрочные детекторные матрицы были сконструированы с использованием пяти групп антител. При различии белков поверхностная отражательная способность приводит к изменению сигнала SPR.Это помогает определить группу крови менее чем за 12 минут (для шестидесяти 5% образцов эритроцитов). Quinn et al. показали, что анализ биоспецифического взаимодействия — популярный метод изучения взаимодействия белков — также может использоваться для определения группы крови. 8 Этот конкретный метод также основан на принципе SPR, но результаты требуют больше времени. Hayden et al. разработали методику использования молекулярно импринтированных полимеров для типирования групп ABO. 9 Хотя этот метод дешев и, возможно, проще в реализации, он все же занимает гораздо больше времени.

Гордон и др. Изобрели оптический биодиск, который позволяет определять группу крови в течение 10 минут с использованием 10% раствора эритроцитов. 10 Диск сканируется лазером в оптическом приводе вместе со специализированной компьютерной программой, используемой для определения группы крови. Другой эффективный метод был предложен Kim et al. Это занимает 3 минуты и образец объемом 3 мкл, чтобы определить группу крови просто невооруженным глазом. 11 Для этого метода был разработан недорогой микрожидкостный биочип.В методике заявлено об успешном обнаружении групп крови A, B и AB, но отсутствуют какие-либо комментарии о группе крови O.

В этой статье предлагается новый неинвазивный метод, который определяет группы крови в течение нескольких минут. Метод зависит от использования оптической системы, состоящей из оптических передатчиков (Txs) и приемников (Rxs), которые стратегически расположены вокруг трубок с кровью или биомедицинских средств крови. Эта оптическая система работает в частотной области, которая может использоваться для измерения двух важных параметров, связанных с падающим модулированным сигналом.Изменение амплитуды и фазы падающей фотонной волны, связанное с поглощением и рассеянием биологической средой, представлено в частотной области как вносимые потери (IL) и фаза вставки (IP), где IL — это изменение амплитуды, а IP это изменение фазы. Это измерение IL и IP требует определенного оборудования и испытательного оборудования, которое будет выполнять высокочастотную модуляцию. Вся система будет состоять из автоматического анализатора цепей (Anritsu MS4623B) в качестве источника РЧ и чувствительного радиочастотного (РЧ) приемника, оптического передатчика и оптического приемника. 12

Всякий раз, когда фотоны с однородными оптическими свойствами модулируются синусоидально (в частотной области), возникает волна плотности фотонов, которая распространяется сферически в биологическое вещество. Затем фотоны будут случайным образом рассеиваться по разным путям, что приводит либо к поглощению, либо к рассеянию. Чтобы инициировать эту модальность модуляции фотонной волны, требуется устройство радиочастотной модуляции. 12 Существует взаимосвязь между миграцией фотонов на определенных длинах волн и биоматерией.Частично это можно объяснить базовым пониманием потребности человеческого органа в кислороде. 13 Оптические свойства биологических сред на основе ближней инфракрасной области (NIR) показали потенциал в измерении чувствительности к поглощению и рассеянию воды, оксигенированного и деоксигенированного гемоглобина на различных длинах волн. 13 Что касается любого воздействия, которое приведет к расстройству, нормальная функциональность клеток или органов может быть зарегистрирована нарушением абсорбции оксигенированного или деоксигенированного гемоглобина с использованием технологии рассеянных фотонов NIR. 14 Местоположение и процентное содержание кислорода, абсорбированного в соответствующих частях тела человека, может быть связано с различными физиологическими действиями и может быть обнаружено с помощью оптической спектроскопии NIR. Измерение снижения деоксигенированного гемоглобина или увеличения оксигенированного гемоглобина может указывать на увеличение объема оксигенированной или деоксигенированной крови. Это локализует информацию, относящуюся к различным функциям, и может помочь в более ранней диагностике различных заболеваний или аномальной активности органа или клетки. 13

В этой статье исследуется широкополосная частотно-модулированная волна фотонов, которые движутся в трубках с кровью (режим передачи) и в нижней части предплечья человека (режим отражения). Группы крови идентифицируются по антигенам и антителам: антигены — это белки, расположенные на поверхности эритроцитов, а антитела — это белки, расположенные в плазме. Структура белка и скопления в крови определяют каждую группу и тип крови, и каждая структура имеет уникальное взаимодействие фотонов.Взаимодействие фотонов с белками имеет уникальную сигнатуру, когда фотоны, проходящие через белки, рассеиваются (структура белков) и поглощаются (накопление белков). Это наблюдается с помощью узкополосных / широкополосных измерений. Измерения могут быть выполнены с помощью одночастотной модуляции (одноточечные данные) и узкополосной и широкополосной частотной модуляции (многоточечные данные), где одночастотная модуляция показывает только одноточечные данные, которых недостаточно для выявления различий в группе крови, в то время как узкая и широкополосная частотная модуляция показывает данные по нескольким точкам, которых достаточно для идентификации разных групп крови.В статье также представлено сравнение экспериментальных результатов на длине волны 850 нм для количественной оценки понимания широкополосной и узкой модуляции фотонов. 13,15 Это делается путем сравнения результатов IL и IP известных групп крови. Методология и математическое представление модулированной волны фотонов объясняются в разделе «Методология исследования», а экспериментальный метод вместе с разработкой оборудования объясняется в разделе «Экспериментальная разработка и разработка оборудования».Результаты: в разделе широкополосных частотных измерений представлены результаты измерений in vitro (пробирка с кровью) и in vivo (нижняя часть предплечья), а в разделе «Обсуждение и заключение» представлены выводы и обсуждения, в которых точность устройства анализируется с использованием ложноотрицательной ошибки.

Методология исследования

Математическое представление

Общее уравнение диффузии (DE) используется в нашем анализе для анализа широкополосной частотной модуляции и решения обратной задачи для извлечения оптических параметров в среде любого биологического типа. 15 Полученное уравнение диффузии утверждает:

(1)

где ϕ (r, t) — плотность потока энергии (w / mm 2 ) ) для режима отражения (обратного рассеяния) или пропускания, а c — скорость света в среде. Волна плотности фотонов выражается для синусоидального точечного источника, модулированного на угловой частоте ω = 2πf в полубесконечной среде как 12,16

(2)

(3)

где A dc и A постоянного тока компоненты являются источником соответственно, δ — глубина проникновения постоянного тока, а k real и k imag являются действительной и мнимой составляющими комплексного волнового числа волны парной плотности.Следовательно, решение для режима отражения дается формулой 12,16

(4)

02

5)

113

где термин r 0 означает

(5.1)

(5,2)

03

(5,4)

(5.5)

(5,6)

где — коэффициент диффузии, r — расстояние между передатчиком и приемником, и C — скорость света в среде. IP и IL используют величину и фазу RF-компонентов A ac как

(6)

(7)

Экспериментально необходимы измерения как IL, так и IP на разных частотах, и требуется полная настройка оборудования, которая имеет полную оптическую систему NIR с возможностью модуляции волны фотонов.

Экспериментальная разработка и разработка оборудования

Общая измерительная система, разработанная и реализованная для этого исследования, состоит из автоматического анализатора цепей (ANA — Anritsu MS4623B) в качестве источника ВЧ и чувствительного приемника ВЧ, широкополосного оптического Tx на различных длинах волн и оптического Модули Rx, как показано на рисунке 1. ANA действует как высокочувствительный прибор частотного модулятора и демодулятора, в то время как оптический передатчик и приемные модули действуют как источники фотонов с широкополосной модуляцией и высокочувствительный (т.е. шум малой интенсивности) оптический детекторы.В этом исследовании используются оптические передатчики, работающие на длине волны 850 нм, для контроля пикового поглощения или рассеяния. Частотная модуляция источника фотонов управляется переключателем SP3T RF (Hittite HMC245QS16) для управления тремя мощными лазерами с вертикальным резонатором, излучающими поверхность (680 нм, 795 и 850 нм). Отдельное управление смещением постоянного тока и модулирующие радиочастотные сигналы предоставляются для каждой длины волны через сети смещения нижних частот – верхних частот. Лазер, излучающий поверхность с вертикальным резонатором, представляет собой диодный лазер (Vixar; модуль V3WLM), в котором оптические источники излучают мощные (выходная мощность около 5 мВт) гауссовы оптические лучи с низким астигматизмом при пороговых токах 8.5 мА для 680 нм, 9,5 мА для 795 нм и 2,8 мА для 850 нм. Печатная плата была разработана и изготовлена ​​с использованием коммерческой подложки (FR4) для размещения всех компонентов технологии поверхностного монтажа. Из-за отсутствия коммерческих оптических приемников с высоким коэффициентом усиления на основе фотодиодов на основе PIN-кода использовался APD (модуль Hamamatsu APD C5658) вместе со встроенным трансимпедансным усилителем. 12

Рисунок 1 Концептуальная система измерения.

Сокращения: IL, вносимые потери; IP, фаза вставки; VCSEL, лазер с вертикальным резонатором, излучающий на поверхность; РФ, радиочастота.

Результаты: широкополосные частотные измерения

Фотоны проникают в биомедиа разными путями и глубинами. И глубина, и путь зависят от различных частотных модуляций волны. 15 Путь фотонов принимает форму обратного рассеяния, когда среда достаточно толстая; в противном случае при представлении тонкой среды потребовалось бы движение передачи от одного конца к другому. 17 Обратное рассеяние фотонов более реалистично, когда человеческое тело представлено как биосреда. Каждая частотная модуляция волны фотонов приведет к разной глубине проникновения фотонов в биосреды, и, следовательно, наблюдаются разные IL и IP, что приводит к разной процедуре извлечения и разной точности. Известно, что узкополосная / широкополосная модуляция фотонов в однородной среде приведет к высокой точности из-за извлеченной информации о многослойном проникновении. 12 Узкая / широкополосная связь приведет к выборкам с высокими точками данных из однородной среды, что приведет к высокой точности при применении решения обратной задачи для извлечения оптических параметров. 12,15–17

Этап 1: Измерения в режиме передачи in vitro

Случайные образцы крови с неизвестной группой были собраны у 30 пациентов (всего 240 образцов) и протестированы с использованием разработанного метода режима передачи, показанного на рисунке 2. Оба IL и IP были измерены и усреднены для каждого образца крови, как показано на рисунках 3 и 4.Затем эти результаты сравнивали с фактической группой крови, подтвержденной обычным типированием ABO, в результате чего была получена табличная карта, показанная в таблице 1. В таблице 1 показан результат табличного индекса, который будет использоваться в качестве эталона для измерений на этапе 2.

Рис. 2 Оптические измерения в режиме передачи через пробирки с кровью.

Рисунок 3 Режим широкополосной передачи (через пробирки с кровью) результат вносимых потерь (IL).

Рисунок 4 Режим широкополосной передачи (через пробирки с кровью) результат фазы введения (IP).

Таблица 1 Результат индекса режима передачи IL и IP, сопоставленных с разными группами крови

Сокращения: IL, вносимая потеря; IP, фаза вставки.

В таблице 1 представлена ​​важная извлеченная информация об ИЛ и ИП различных проверенных групп крови.

В принципе, антигены и антитела имеют одинаковые извлеченные значения ИЛ для каждой группы крови, но антигены RhD этих групп крови имеют разные IP. Результаты показывают уникальную биографическую отметку различных IL и IP, которая может использоваться для идентификации различных типов крови и может использоваться в качестве эталона для идентификации неинвазивных (in vivo) измерений, о которых сообщается в следующем разделе.

Этап 2: Измерения нижней части предплечья in vivo

Метод измерений и анализа

Измерения в режиме отражения используются как неинвазивный метод для измерения фотонов, перемещающихся в биосредах.И оптический передатчик, и приемник расположены рядом друг с другом для измерения фотонов, движущихся в обратном рассеянии, проходящих через намеченный / желаемый биообъект. Раньше нижняя часть предплечья изучалась с целью измерения рассеяния и поглощения фотонов при путешествии на определенных глубинах и в определенных местах. 12 Зная расположение и глубину кровеносной артерии, необходимые для таких измерений, затем используется узкая полоса 245–607 МГц для модуляции волны фотонов на длине волны 850 нм. 12 Выбранная узкая полоса гарантирует, что фотоны будут взаимодействовать с нужной кровеносной артерией при прохождении через нижнюю часть предплечья. Для таких измерений нацелена либо локтевая, либо лучевая артерия. Как показано на рисунке 5, полоса оптического передатчика и приемника размещается в месте для измерения фотонов, проходящих через нижнюю часть предплечья человека, и нацеливания либо на локтевую, либо на лучевую артерию. Для целей анализа результат всегда сравнивается с контрольным (буферным) местом, где наблюдается низкое поглощение и рассеяние фотонов.Метод обработки сигналов для анализа данных, показанный на рисунке 6, основан на предыдущем методе / подходе, который был разработан 15–18 путем вычитания и взятия первой или второй производной следующим образом:

Рис. 5 Оптические измерения в режиме отражения через нижнюю часть предплечья.

Сокращения: Rx, приемник; Tx, передатчик.

Рис. 6 Процедура обработки сигнала для идентификации изменения наклона и штампа частоты, связанного с ним.

Сокращения: IL, вносимые потери; IP, фаза вставки.

Дифференциация ∆IL и ∆IP подчеркивает изменение наклона и, следовательно, определяет точку взаимодействия между фотонами и целевой биосредой (кровяная артерия).

В качестве показателя частотно-модулированного взаимодействия фотонной волны с различными биосредами наблюдается изменение наклона результирующих IL и IP по сравнению с контрольными (буферными) IL и IP.Изменение наклона IL / IP между контрольным (буфером) и реальными измерениями неоднородной среды дает указание, которое может быть коррелировано со значениями индексов для различных групп крови, указанных в таблице 1.

Измерения и обработка данных

Сорок случайно выбранных пациентов из каждой группы крови (всего 320 образцов) были протестированы с помощью методики измерения, предложенной в этой статье и показанной на рисунке 5. Первоначальные измерения обратного рассеяния страдали из-за высокой потери фотонов и плохого сбора данных.Это было связано с движением фотонов в среде с очень сильным рассеянием. Поэтому управляемый радиочастотный усилитель Hittite / Analog Device (HMC453ST89) был помещен после оптического приемника, чтобы иметь усиление 10 дБ. Затем измерения дали лучшее разрешение с достаточным количеством точек данных для анализа. Оба рисунка 7 и 8 показывают результат производных от ∆IL и ∆IP, и наблюдаются пики около 401 МГц. Все пики, представленные в таблице 2, должны быть сопоставлены с измерениями индексного режима передачи в Этапе 1: раздел измерений режима передачи in vitro и в таблице 1.

Рис. 7 Измерения средних вносимых потерь (IL) для нижней части предплечья в режиме отражения.

Рис. 8 Усредненные измерения фазы вставки (IP) для нижней части предплечья в режиме отражения.

Таблица 2 Пиковый усредненный результат ∆IL и ∆IP для нижней части предплечья в режиме отражения

Сокращения: IL, вносимые потери; IP, фаза вставки.

Результаты, представленные в таблице 2, были извлечены из неинвазивных экспериментальных измерений волны фотонов, движущихся в нижней части предплечья человека. Эти результаты были усреднены и сравнены с уникальной биографической меткой, представленной в таблице 1. Было проведено измерение корреляции между таблицами 1 и 2, которое объясняется в следующем разделе вместе с обсуждением важности таких результатов биосенсора.

Обсуждение и заключение

Слепой неинвазивный метод оптических измерений был использован в этом исследовании в качестве биосенсорного метода для определения групп крови человека посредством измерений крови in vitro или in vivo.Этот метод демонстрирует высокую точность и может быть использован в качестве будущего инструмента для неинвазивной идентификации групп крови человека без сбора образцов крови от людей. Этот метод зависит от волны фотонов, проходящей через биосферу человека, и измерений поглощения (IL) и рассеяния (IP) фотонов, которые сопоставлены с различными группами крови (Таблица 1). Первым шагом к проверке точности используемого здесь метода является создание индекса, который может быть уникальной сигнатурой для каждой группы крови. Индекс основан на двух показаниях IL и IP, которые в основном представляют собой измерение количества фотографий, которые были поглощены и разбросаны.Об этой задаче было сообщено в разделе «Этап 1: Измерения в режиме передачи in vitro», где использовались различные образцы крови от 30 пациентов. Второй шаг — неинвазивное измерение поглощения (IL) и рассеяния (IP) этих волн фотонов, проходящих через нижнюю часть предплечья человека, и это было сделано у 40 различных пациентов, и результаты представлены в Этапе 2: In vivo нижняя часть предплечья. раздел измерений. Результаты Этапа 2: Раздел измерений нижней части предплечья in vivo и Этапа 1: Раздел измерения режима передачи in vitro были проанализированы, чтобы обеспечить корреляцию между значениями индекса (Этап 1: Раздел измерения режима передачи In vitro) и случайными неинвазивными измерениями 40 пациенты, представленные на этапе 2: раздел измерения нижней части предплечья in vivo.Значения корреляции> 0,95 показаны на рисунке 9 как для IL, так и для IP. Это дает высокую уверенность в методе измерения, используемом для неинвазивной идентификации группы крови с использованием оптического метода, описанного в этой статье.

Рис. 9 Корреляционный анализ между этапом 1 и этапом 2 (результат индекса для неинвазивных измерений нижней части предплечья).

Сокращение: IL, вносимые потери.

Было обнаружено, что пациенты с ожирением вызывают смещение оптического передатчика и приемника и, следовательно, вызывают ошибку в прогнозировании группы крови.Поэтому для целей точных измерений дальнейшее тестирование с использованием ложноотрицательных показаний устройства анализируется путем выполнения 480 прогнозных измерений крови у людей. Это было сделано путем случайного отбора 60 человек из каждой группы крови (A +, A-, B +, B-, AB +, AB-, O + и O-). Было выполнено дополнительное тестирование с шагом несовпадения 0,5 см, как показано в таблице 3. Для каждого теста мы провели три дополнительных измерения, когда передатчик и приемник были несовмещены с шагом 0,5. Несовпадение было бы реалистичным результатом при работе с людьми с ожирением.Измерения и прогнозирование группы крови с использованием метода, разработанного в этой статье, были выполнены на каждом из 480 человек, а затем сравнивались с известной группой крови лабораторных результатов. Ложноотрицательные результаты были измерены путем деления количества ошибочных прогнозов на общее количество субъектов для каждого измерения группы крови.

Таблица 3 Ложноотрицательная процентная ошибка (FN), выполненная на 480 пациентах (60 пациентов с каждой группой крови)

Результат показывает, что когда устройство сосредоточено вокруг артерии и представлен средний вес человека, тогда ошибка обнаружения ложноотрицательных результатов составляет <5%, но когда представлены пациенты с ожирением, ошибка увеличивается, как показано на Рисунке 10.Это оправдано расположением оптического диапазона вокруг целевой артерии или потерей фотонов из-за сильно рассеивающей среды. Новая измерительная система, над которой мы работаем, должна быть откалибрована с высокой точностью со встроенным РЧ-усилением. В будущем мы работаем над увеличением точек выборки за счет неинвазивного измерения большего количества случайных пациентов.

Рис. 10 Ложноотрицательные результаты (ЛО) для 480 человек, протестированных для прогнозирования группы крови человека с использованием неинвазивного оптического устройства.

Несмотря на то, что система, разработанная в этой статье, обеспечивает достаточную чувствительность для измерений крови, необходимо разработать новую систему для решения проблемы чувствительности оптических передатчиков, приемников и радиочастотных компонентов. Новые разработки должны иметь более высокую чувствительность обнаружения и больше функций мобильности. Низкая чувствительность наблюдалась при применении режима отражения к людям с ожирением.

В этой статье мы создали индексированную базу данных, используя измерения режима оптической передачи, а затем сопоставили ее с неинвазивным измерением отражения для определения групп крови.Затем с целью обеспечения точности устройства мы случайным образом выбрали 480 новых людей для измерения процента ложноотрицательных ошибок. Этот метод является новым с точки зрения использования оптической системы для измерения и идентификации групп крови без сбора образцов крови.

Возможность интеграции неинвазивных устройств для определения группы крови позволит пациенту и врачу получать немедленные ответы без боли в отличие от традиционных инвазивных методов, как показано на рисунке 11. Это может быть применено к различным аспектам здоровья, которые связаны с кровью. мониторинг, от определения типа, мониторинга диабета или определения обнаружения рака.Интеграция использования носимых интеллектуальных устройств приведет гематологию в соответствие с другими областями медицины, которые выиграли от внедрения новых технологий.

Рис. 11 Оптический биосенсор : прошлое, настоящее и футуристическое развитие для неинвазивного определения группы крови.

Согласие пациента

Авторы подтверждают, что все пациенты, участвовавшие в этом исследовании, предоставили подписанное письменное информированное согласие.

Доступность данных и кода

Данные и коды, подтверждающие выводы этого исследования, доступны у соответствующего автора по разумному запросу.

Благодарности

Эта работа была поддержана исследовательским грантом PAAET (номер TS14-09). Авторы хотели бы поблагодарить доктора Yaqoub Borjaib из Кувейтского военного госпиталя и Государственное управление прикладного образования и обучения за их поддержку.

Раскрытие информации

Авторы подтверждают соответствие последней версии Хельсинкской декларации и заявляют, что у них нет конкурирующих интересов или конфликта интересов.Авторы также дают согласие на то, что исследование было рассмотрено и одобрено исследовательским комитетом в секторе биомедицинской инженерии Колледжа технологических исследований Департамента электронной инженерии, Шувайх, Кувейт. Исследовательский комитет рассмотрел и одобрил это исследование, гарантируя высокую удовлетворительную работу, имеющую значительную ценность и соблюдение этических норм.

Ссылки

1.

Тодд К., Сальветти П., Нейлор К., Альбатат М.К неинвазивной экстракции и определению уровня глюкозы в крови. Биоинженерия. 2017; 4: 82.

2.

Канада В. Биооптика: определение группы крови на основе методов обработки изображений с использованием оптического сенсорного устройства. Int J Sci Res. 2016; 5 (7): 214–217.

3.

Определение группы крови человека неинвазивными методами. Доступно по адресу: http: // www.ableweb.org/biologylabs/wp-content/uploads/volumes/vol-29/012.pdf.

4.

Гото С. Сосудистая инженерия свертывания крови. В: Танишита К., Ямамото К., редакторы. Сосудистая инженерия. Токио: Спрингер; 2016: 211–220.

5.

Харменнинг DM. Современные методы банка крови и переливания . Филадельфия, Пенсильвания: Ф. А. Дэвис; 2012.

6.

Stussi G, Huggel K, Lutz HU, Schanz U, Rieben R, Seebach JD. Изотип-специфическое определение антител группы крови ABO с использованием нового метода проточной цитометрии. Br J Haematol . 2005. 130 (6): 954–963.

7.

Houngkamhang N, Vongsakulyanon A, Peungthum P, et al. Типирование крови по системе АВО с использованием метода массива антител, основанного на томографии поверхностного плазмонного резонанса. Датчики . 2013. 13 (9): 11913–11922.

8.

Quinn JG, O’Kennedy R, Smyth M, Molds J, Frame T. Обнаружение антигенов группы крови с использованием иммобилизованных антител и поверхностный плазмонный резонанс. Дж. Иммунологические методы . 1997. 206 (1-2): 87–96.

9.

Hayden O, Mann K-J, Krassnig S, Dickert FL. Биомиметическое определение группы крови по системе АВО. Angewandte Chemie International Edition. 2006; 45: 2626–2629.

10.

Gordon JF, Hurts SN, Cohen DS. Методы и аппараты для определения группы крови с помощью оптического биодиска. Патент США US 7087203. 8 августа 2006 г.

11.

Kim DS, Lee SH, Ahn CH, Lee JY, Kwon TH. Одноразовый встроенный микрожидкостный биочип для определения группы крови методом микроинъекционного формования пластика. Лабораторный чип . 2006. 6 (6): 794–802.

12.

Sultan E, Manseta K, Khwaja A. et al. Проблемы моделирования и извлечения параметров тканей для систем визуализации мозга с широкополосным fNIR в свободном пространстве. Proc SPIE . 2011; 7902: 7.

13.

Mansouri C, Kashou NH. Новое окно в оптическую визуализацию мозга: медицинские разработки, моделирование и приложения. В: Редакторы Ясин М., Харун С.В., Ароф Х. Избранные темы волоконно-оптических технологий .Риека, Хорватия: InTech; 2012: 271–288. 2012.

14.

Wu J-S, Yu L-P, Chou C. Измерение поверхностного эффекта небольшого рассеивающего объекта в сильно рассеивающей среде с использованием диффузной волны плотности пар фотонов. Дж Биомед Опт . 2016; 21 (6): 060504.

15.

Султан Э., Алхатиб Н. Характеристика частотно-модулированной волны переноса фотонов ближнего ИК-диапазона в фантоме нижней части предплечья человека. Int J Биомедицинская инженерия и технологии . Под давлением.

16.

Султан Э., Наджафизаде Л., Ганджбахче А.Х., Поуррезаи К., Дарюш А. Процедура точного извлечения оптических параметров для широкополосной спектроскопии вещества мозга в ближнем инфракрасном диапазоне. Дж Биомед Опт . 2013; 18 (1): 017008.

17.

Sultan E, Pourrezaei K, Ghandjbakhche A, Daryoush AS.Трехмерное численное моделирование и его экспериментальная проверка для неоднородного фантома головы с использованием широкополосной системы fNIR. Int J Numer Method Biomed Eng . 2014. 30 (3): 353–364.

18.

Sultan E, Ahmad N, Daryoush AS. Диагностика опухолей кисти с помощью оптической системы fNIR. Int J Biosci Biotech. 2017; 9 (2): 49–58.

Рекомбинантный белок группы крови человека Kell Antigen (ab116891)

Описание

  • Название продукта

    Рекомбинантный белок группы крови человека Kell Antigen

  • Система выражений

    Зародыши пшеницы

  • Присоединение

  • Длина белка

    Белок полной длины

  • Без животных

  • Природа

    Рекомбинантный

    • Виды

      Человек

    • Последовательность

      MEGGDQSEEEPRERSQAGGMGTLWSQESTPEERLPVEGSRPWAVARRVLT AILILGLLLCFSVLLFYNFQNCGPRPCETSVCLDLRDHYLASGNTSVAPC TDFFSFACGRAKETNNSFQELATKNKNRLRRILEVQNSWHPGSGEEKAFQ FYNSCMDTLAIEAAGTGPLRQVIEELGGWRISGKWTSLNFNRTLRLLMSQ YGHFPFFRAYLGPHPASPHTPVIQIDQPEFDVPLKQDQEQKIYAQIFREY LTYLNQLGTLLGGDPSKVQEHSSLSISITSRLFQFLRPLEQRRAQGKLFQ MVTIDQLKEMAPAIDWLSCLQATFTPMSLSPSQSLVVHDVEYLKNMSQLV EEMLLKQRDFLQSHMILGLVVTLSPALDSQFQEARRKLSQKLRELTEQPP MPARPRWMKCVEETGTFFEPTLAALFVREAFGPSTRSAAMKLFTAIRDAL ITRLRNLPWMNEETQNMAQDKVAQLQVEMGASEWALKPELARQEYNDIQL GSSFLQSVLSCVRSLRARIVQSFLQPHPQHRWKVSPWDVNAYYSVSDHVV VFPAGLLQPPFFHPGYPRAVNFGAAGSIMAHELLHIFYQLLLPGGCLACD NHALQEAHLCLKRHYAAFPLPSRTSFNDSLTFLENAADVGGLAIALQAYS KRLLRHHGETVLPSLDLSPQQIFFRSYAQVMCRKPSPQDSHDTHSPPHLR VHGPLSSTPAFARYFRCARGALLNPSSRCQLW

    • Расчетная молекулярная масса

      107 кДа, включая метки

    • Аминокислоты

      1 до 732

Технические характеристики

Наша гарантия Abpromise распространяется на использование ab116891 в следующих протестированных приложениях.

Примечания по применению включают рекомендуемые начальные разведения; Оптимальные разведения / концентрации должны определяться конечным пользователем.

  • Приложения

    СТРАНИЦА SDS

    Вестерн-блоттинг

    ELISA

  • Форма

    Жидкость

  • Загрузка информации о концентрации…

Подготовка и хранение

  • Стабильность и хранение

    Поставляется на сухом льду. После доставки аликвотировать и хранить при -80ºC. Избегайте циклов замораживания / оттаивания.

    pH: 8,00
    Состав: 0,3% глутатиона, 0,79% трис-HCl

Общая информация

  • Альтернативные названия

    • кель
    • Келл группа крови
    • Гликопротеин группы крови Kell
    • Металлоэндопептидаза группы крови Kell
    • Металлоэндопептидаза группы крови Kell
    • KELL NULL
    • Белок келл
    • KELL_HUMAN

    посмотреть все

  • Функция

    Цинк-эндопептидаза с активностью фермента, превращающего эндотелин-3.

  • Сходства последовательностей

    Принадлежит к семейству пептидаз M13.

  • Сотовая локализация

    Клеточная мембрана. Охватывает мембрану эритроцита и прикрепляется к нижележащему цитоскелету.

  • Информация от UniProt

Протоколы

Насколько нам известно, для этого продукта не требуются индивидуальные протоколы.Пожалуйста, попробуйте стандартные протоколы, перечисленные ниже, и сообщите нам, как у вас дела.

Щелкните здесь, чтобы просмотреть общие протоколы

Список литературы (0)

ab116891 еще не упоминался в каких-либо публикациях.

Мнения клиентов, вопросы и ответы

% PDF-1.4 % 528 0 объект > эндобдж xref 528 784 0000000016 00000 н. 0000017564 00000 п. 0000017731 00000 п. 0000018556 00000 п. 0000019082 00000 п. 0000019677 00000 п. 0000020130 00000 н. 0000020675 00000 п. 0000021205 00000 п. 0000021834 00000 п. 0000021946 00000 п. 0000022060 00000 н. 0000022166 00000 п. 0000022495 00000 п. 0000022877 00000 п. 0000024247 00000 п. 0000024701 00000 п. 0000025232 00000 п. 0000025676 00000 п. 0000025769 00000 п. 0000026748 00000 н. 0000027908 00000 н. 0000028139 00000 п. 0000028625 00000 п. 0000029052 00000 п. 0000029541 00000 п. 0000029941 00000 н. 0000030026 00000 п. 0000030437 00000 п. 0000031638 00000 п. 0000032130 00000 н. 0000032504 00000 п. 0000032979 00000 п. 0000034478 00000 п. 0000034602 00000 п. 0000034716 00000 п. 0000036103 00000 п. 0000037330 00000 п. 0000038452 00000 п. 0000041419 00000 п. 0000051795 00000 п. 0000054253 00000 п. 0000061560 00000 п. 0000064111 00000 п. 0000067495 00000 п. 0000067618 00000 п. 0000067733 00000 п. 0000067856 00000 п. 0000067979 00000 п. 0000068104 00000 п. 0000069855 00000 п. 0000070175 00000 п. 0000070567 00000 п. 0000106838 00000 п. 0000106877 00000 н. 0000143966 00000 н. 0000144005 00000 н. 0000179289 00000 н. 0000179328 00000 н. 0000215059 00000 н. 0000215098 00000 н. 0000250829 00000 н. 0000250868 00000 н. 0000250946 00000 н. 0000251059 00000 н. 0000251466 00000 н. 0000251544 00000 н. 0000251903 00000 н. 0000251981 00000 н. 0000252363 00000 н. 0000252440 00000 н. 0000252517 00000 н. 0000252594 00000 н. 0000252948 00000 н. 0000253322 00000 н. 0000253399 00000 н. 0000253476 00000 н. 0000253830 00000 н. 0000254203 00000 н. 0000254280 00000 н. 0000254357 00000 н. 0000254707 00000 н. 0000255080 00000 н. 0000255157 00000 н. 0000255234 00000 н. 0000255620 00000 н. 0000256035 00000 н. 0000256112 00000 н. 0000256189 00000 н. 0000256545 00000 н. 0000256935 00000 н. 0000257012 00000 н. 0000257089 00000 н. 0000257444 00000 н. 0000257835 00000 н. 0000257912 00000 н. 0000257989 00000 н. 0000258337 00000 н. 0000258715 00000 н. 0000258792 00000 н. 0000258869 00000 н. 0000259228 00000 н. 0000259598 00000 н. 0000259675 00000 н. 0000259752 00000 н. 0000260109 00000 н. 0000260478 00000 н. 0000260555 00000 н. 0000260632 00000 н. 0000260990 00000 н. 0000261371 00000 н. 0000261448 00000 н. 0000261525 00000 н. 0000261877 00000 н. 0000262248 00000 н. 0000262325 00000 н. 0000262402 00000 н. 0000262757 00000 н. 0000263132 00000 н. 0000263209 00000 н. 0000263286 00000 н. 0000263638 00000 н. 0000264007 00000 н. 0000264084 00000 н. 0000264161 00000 п. 0000264516 00000 н. 0000264899 00000 н. 0000264976 00000 н. 0000265053 00000 н. 0000265407 00000 н. 0000265780 00000 н. 0000265857 00000 п. 0000265934 00000 н. 0000266278 00000 н. 0000266651 00000 п. 0000266728 00000 н. 0000266805 00000 н. 0000267146 00000 н. 0000267518 00000 н. 0000267595 00000 н. 0000267672 00000 н. 0000268027 00000 н. 0000268399 00000 н. 0000270914 00000 п. 0000270992 00000 н. 0000271391 00000 н. 0000271469 00000 н. 0000271860 00000 н. 0000271938 00000 н. 0000272413 00000 н. 0000272491 00000 н. 0000272886 00000 н. 0000272963 00000 н. 0000273040 00000 н. 0000273117 00000 н. 0000273471 00000 н. 0000273859 00000 н. 0000273936 00000 н. 0000274013 00000 н. 0000274394 00000 н. 0000274796 00000 н. 0000274873 00000 н. 0000274950 00000 н. 0000275305 00000 н. 0000275680 00000 н. 0000275757 00000 н. 0000275834 00000 н. 0000276189 00000 н. 0000276564 00000 н. 0000276641 00000 н. 0000276718 00000 н. 0000277072 00000 н. 0000277464 00000 н. 0000277541 00000 н. 0000277618 00000 н. 0000277971 00000 н. 0000278343 00000 н. 0000278420 00000 н. 0000278497 00000 н. 0000278842 00000 н. 0000279212 00000 н. 0000279289 00000 н. 0000279366 00000 н. 0000279715 00000 н. 0000280086 00000 н. 0000280163 00000 п. 0000280240 00000 н. 0000280718 00000 н. 0000281468 00000 н. 0000281545 00000 н. 0000281622 00000 н. 0000281972 00000 н. 0000282341 00000 п. 0000282418 00000 н. 0000283025 00000 н. 0000283102 00000 п. 0000283179 00000 н. 0000283533 00000 н. 0000283931 00000 н. 0000284008 00000 н. 0000284085 00000 н. 0000284436 00000 н. 0000284803 00000 н. 0000284880 00000 н. 0000285476 00000 н. 0000285553 00000 н. 0000285630 00000 н. 0000285978 00000 н. 0000286354 00000 п. 0000286431 00000 н. 0000286945 00000 н. 0000287022 00000 н. 0000287525 00000 н. 0000287602 00000 н. 0000287679 00000 н. 0000288033 00000 н. 0000288411 00000 н. 0000288488 00000 н. 0000289020 00000 н. 0000289097 00000 н. 0000289617 00000 н. 0000289694 00000 н. 00002 00000 н. 00002 00000 н. 00002

00000 н. 00002

00000 н. 00002 00000 н. 00002 00000 н. 0000291692 00000 н. 0000291769 00000 н. 0000291846 00000 н. 0000292187 00000 н. 0000292560 00000 н. 0000292637 00000 н. 0000292714 00000 н. 0000293070 00000 н. 0000293445 00000 н. 0000293522 00000 н. 0000293599 00000 н. 0000294048 00000 н. 0000294564 00000 н. 0000294641 00000 н. 0000295093 00000 н. 0000295170 00000 н. 0000295247 00000 н. 0000295598 00000 н. 0000295972 00000 н. 0000296049 00000 н. 0000296126 00000 н. 0000296483 00000 н. 0000296856 00000 н. 0000296933 00000 н. 0000297010 00000 н. 0000297359 00000 н. 0000297737 00000 н. 0000297814 00000 н. 0000297891 00000 н. 0000298245 00000 н. 0000298620 00000 н. 0000298697 00000 н. 0000298774 00000 н. 0000299129 00000 н. 0000299500 00000 н. 0000299577 00000 н. 0000299654 00000 н. 0000300000 00000 п. 0000300368 00000 н. 0000300445 00000 н. 0000300522 00000 н. 0000301002 00000 н. 0000301559 00000 н. 0000301636 00000 н. 0000301713 00000 н. 0000302069 00000 н. 0000302442 00000 н. 0000302519 00000 н. 0000302596 00000 н. 0000302984 00000 н. 0000303406 00000 п. 0000303483 00000 н. 0000303560 00000 н. 0000303909 00000 н. 0000304285 00000 н. 0000304362 00000 п. 0000304439 00000 н. 0000304794 00000 н. 0000305174 00000 п. 0000305251 00000 н. 0000305328 00000 н. 0000305676 00000 н. 0000306059 00000 н. 0000306136 00000 н. 0000306213 00000 н. 0000306568 00000 н. 0000306944 00000 н. 0000307021 00000 н. 0000307098 00000 н. 0000307453 00000 н. 0000307825 00000 н. 0000307902 00000 н. 0000307979 00000 н. 0000308325 00000 н. 0000308696 00000 п. 0000308773 00000 н. 0000308850 00000 н. 0000309195 00000 н. 0000309565 00000 н. 0000309642 00000 н. 0000309719 00000 н. 0000310072 00000 н. 0000310447 00000 н. 0000310524 00000 н. 0000310601 00000 п. 0000310975 00000 н. 0000311382 00000 н. 0000311459 00000 н. 0000311536 00000 н. 0000311895 00000 н. 0000312266 00000 н. 0000312343 00000 п. 0000312420 00000 н. 0000312766 00000 н. 0000313140 00000 п. 0000313217 00000 н. 0000313294 00000 н. 0000313646 00000 н. 0000314017 00000 н. 0000314094 00000 н. 0000314171 00000 н. 0000314550 00000 н. 0000314963 00000 н. 0000315040 00000 н. 0000315117 00000 н. 0000315474 00000 н. 0000315874 00000 н. 0000315951 00000 н. 0000316028 00000 н. 0000316401 00000 н. 0000316806 00000 н. 0000316883 00000 н. 0000316960 00000 н. 0000317312 00000 н. 0000317687 00000 н. 0000317764 00000 н. 0000317841 00000 н. 0000318194 00000 н. 0000318565 00000 н. 0000318642 00000 н. 0000318719 00000 н. 0000319070 00000 н. 0000319442 00000 н. 0000319519 00000 н. 0000319596 00000 н. 0000319955 00000 н. 0000320348 00000 н. 0000320425 00000 н. 0000320502 00000 н. 0000320882 00000 н. 0000321284 00000 н. 0000321361 00000 н. 0000321438 00000 н. 0000321784 00000 н. 0000322153 00000 н. 0000322230 00000 н. 0000322307 00000 н. 0000322659 00000 н. 0000323033 00000 н. 0000323110 00000 н. 0000323187 00000 н. 0000323541 00000 н. 0000323913 00000 н. 0000323990 00000 н. 0000324067 00000 н. 0000324451 00000 н. 0000324860 00000 н. 0000324937 00000 н. 0000325014 00000 н. 0000325371 00000 н. 0000325745 00000 н. 0000325822 00000 н. 0000325899 00000 н. 0000326253 00000 н. 0000326644 00000 н. 0000326721 00000 н. 0000326798 00000 н. 0000327155 00000 н. 0000327531 00000 н. 0000327608 00000 н. 0000327685 00000 н. 0000328065 00000 н. 0000328468 00000 н. 0000334105 00000 н. 0000334182 00000 п. 0000334259 00000 н. 0000334336 00000 н. 0000334719 00000 н. 0000335127 00000 н. 0000335204 00000 н. 0000335281 00000 п. 0000335637 00000 н. 0000336010 00000 н. 0000336087 00000 н. 0000336164 00000 н. 0000336522 00000 н. 0000336901 00000 н. 0000336978 00000 н. 0000337055 00000 п. 0000337433 00000 н. 0000337844 00000 н. 0000337921 00000 п. 0000337998 00000 н. 0000338421 00000 н. 0000338834 00000 н. 0000338911 00000 н. 0000338988 00000 н. 0000339346 00000 н. 0000339723 00000 н. 0000339800 00000 н. 0000339877 00000 н. 0000340233 00000 н. 0000340632 00000 н. 0000340709 00000 н. 0000340786 00000 н. 0000341140 00000 н. 0000341516 00000 н. 0000341593 00000 н. 0000341670 00000 н. 0000342025 00000 н. 0000342395 00000 п. 0000342472 00000 н. 0000342549 00000 н. 0000342933 00000 н. 0000343343 00000 п. 0000343420 00000 н. 0000343497 00000 н. 0000343851 00000 н. 0000344221 00000 н. 0000344298 00000 н. 0000344375 00000 п. 0000344756 00000 п. 0000345164 00000 н. 0000345241 00000 п. 0000345318 00000 н. 0000345809 00000 н. 0000346511 00000 н. 0000346588 00000 н. 0000346665 00000 н. 0000347015 00000 н. 0000347400 00000 н. 0000347477 00000 н. 0000347554 00000 н. 0000347896 00000 н. 0000348269 00000 н. 0000348346 00000 п. 0000348856 00000 н. 0000348933 00000 н. 0000349575 00000 н. 0000349652 00000 н. 0000349729 00000 н. 0000350074 00000 н. 0000350444 00000 н. 0000350521 00000 н. 0000350598 00000 н. 0000350951 00000 н. 0000351325 00000 н. 0000351402 00000 н. 0000351870 00000 н. 0000351947 00000 н. 0000352466 00000 н. 0000352543 00000 н. 0000352620 00000 н. 0000352962 00000 н. 0000353328 00000 н. 0000353406 00000 н. 0000353939 00000 н. 0000354017 00000 н. 0000354615 00000 н. 0000354693 00000 н. 0000355230 00000 н. 0000355308 00000 н. 0000355852 00000 н. 0000355930 00000 н. 0000356475 00000 н. 0000356553 00000 н. 0000356631 00000 н. 0000357085 00000 н. 0000357695 00000 н. 0000357773 00000 н. 0000357851 00000 н. 0000358212 00000 н. 0000358593 00000 н. 0000358671 00000 н. 0000359454 00000 н. 0000359532 00000 н. 0000360110 00000 н. 0000360188 00000 п. 0000360266 00000 н. 0000360650 00000 н. 0000361060 00000 н. 0000361138 00000 п. 0000361216 00000 н. 0000361568 00000 н. 0000361955 00000 н. 0000362033 00000 н. 0000362440 00000 н. 0000362518 00000 н. 0000363228 00000 н. 0000363306 00000 н. 0000363703 00000 н. 0000363781 00000 п. 0000363859 00000 н. 0000364219 00000 н. 0000364877 00000 н. 0000364955 00000 н. 0000365033 00000 н. 0000365389 00000 н. 0000365805 00000 н. 0000365883 00000 н. 0000366514 00000 н. 0000366592 00000 н. 0000367119 00000 н. 0000367197 00000 н. 0000367844 00000 н. 0000367922 00000 н. 0000368325 00000 н. 0000368403 00000 н. 0000368481 00000 н. 0000368840 00000 н. 0000369347 00000 н. 0000369425 00000 н. 0000369503 00000 н. 0000369857 00000 н. 0000370226 00000 н. 0000370304 00000 н. 0000370697 00000 н. 0000370775 00000 н. 0000371506 00000 н. 0000371584 00000 н. 0000371662 00000 н. 0000372022 00000 н. 0000372423 00000 н. 0000372501 00000 н. 0000372579 00000 н. 0000372933 00000 н. 0000373307 00000 н. 0000373385 00000 н. 0000373934 00000 н. 0000374012 00000 н. 0000374090 00000 н. 0000374446 00000 н. 0000374838 00000 н. 0000374916 00000 н. 0000374994 00000 н. 0000375341 00000 н. 0000375709 00000 н. 0000375787 00000 н. 0000375865 00000 н. 0000376216 00000 н. 0000376605 00000 н. 0000376683 00000 н. 0000377225 00000 н. 0000377303 00000 н. 0000377715 00000 н. 0000377793 00000 н. 0000377871 00000 н. 0000378227 00000 н. 0000378604 00000 н. 0000378682 00000 н. 0000378760 00000 н. 0000379119 00000 н. 0000379518 00000 н. 0000379596 00000 н. 0000379674 00000 н. 0000380185 00000 н. 0000380742 00000 н. 0000380820 00000 н. 0000381220 00000 н. 0000381298 00000 н. 0000381376 00000 н. 0000381725 00000 н. 0000382100 00000 н. 0000382178 00000 п. 0000382256 00000 н. 0000382608 00000 н. 0000382974 00000 н. 0000383052 00000 н. 0000383130 00000 н. 0000383491 00000 н. 0000383895 00000 н. 0000383973 00000 н. 0000384051 00000 н. 0000384411 00000 н. 0000384807 00000 н. 0000384885 00000 н. 0000384963 00000 н. 0000385401 00000 п. 0000385893 00000 н. 0000385971 00000 п. 0000386049 00000 н. 0000386504 00000 н. 0000387031 00000 н. 0000387109 00000 п. 0000387187 00000 н. 0000387644 00000 н. 0000388047 00000 н. 0000388125 00000 н. 0000388203 00000 н. 0000388587 00000 н. 0000388994 00000 н. 0000389072 00000 н. 0000389555 00000 н. 0000389633 00000 н. 00003

00000 н. 00003

00000 п. 00003 00000 н. 00003 00000 н. 00003

00000 н. 00003

00000 н. 0000391663 00000 н. 0000391741 00000 н. 0000392271 00000 н. 0000392349 00000 н. 0000392866 00000 н. 0000392944 00000 н. 0000393022 00000 н. 0000393405 00000 н. 0000393821 00000 н. 0000393899 00000 н. 0000394368 00000 н. 0000394446 00000 н. 0000395121 00000 п. 0000395199 00000 н. 0000395798 00000 н. 0000395876 00000 н. 0000395954 00000 н. 0000396311 00000 н. 0000396683 00000 н. 0000396761 00000 н. 0000397166 00000 н. 0000397244 00000 н. 0000397647 00000 н. 0000397725 00000 н. 0000398342 00000 н. 0000398420 00000 н. 0000398498 00000 н. 0000398961 00000 н. 0000399367 00000 н. 0000399445 00000 н. 0000399523 00000 н. 0000399938 00000 н. 0000400402 00000 п. 0000400480 00000 н. 0000400558 00000 н. 0000400917 00000 н. 0000401295 00000 н. 0000401373 00000 н. 0000401901 00000 н. 0000401979 00000 п. 0000402057 00000 н. 0000402413 00000 н. 0000402792 00000 н. 0000402870 00000 н. 0000403396 00000 н. 0000403474 00000 н. 0000403552 00000 н. 0000403964 00000 н. 0000404425 00000 н. 0000404503 00000 н. 0000404581 00000 н. 0000404925 00000 н. 0000405298 00000 п. 0000405376 00000 п. 0000405454 00000 н. 0000405813 00000 н. 0000406192 00000 н. 0000406270 00000 н. 0000406348 00000 п. 0000406696 00000 н. 0000407095 00000 н. 0000407173 00000 н. 0000407251 00000 н. 0000407632 00000 н. 0000408038 00000 н. 0000408116 00000 п. 0000408194 00000 н. 0000408537 00000 н. 0000408945 00000 н. 0000409023 00000 н. 0000409580 00000 н. 0000409658 00000 н. 0000409736 00000 н. 0000410234 00000 п. 0000410793 00000 п. 0000410871 00000 п. 0000410949 00000 п. 0000411305 00000 н. 0000411679 00000 н. 0000411757 00000 н. 0000412297 00000 н. 0000412375 00000 н. 0000412453 00000 п. 0000412802 00000 н. 0000413171 00000 п. 0000413249 00000 н. 0000413327 00000 н. 0000413680 00000 н. 0000414045 00000 н. 0000414123 00000 н. 0000414201 00000 н. 0000414555 00000 н. 0000414929 00000 н. 0000415007 00000 н. 0000415085 00000 н. 0000415464 00000 н. 0000415876 00000 н. 0000415954 00000 н. 0000416032 00000 н. 0000416385 00000 н. 0000416764 00000 н. 0000416842 00000 н. 0000416920 00000 н. 0000417269 00000 н. 0000417644 00000 н. 0000417722 00000 н. 0000417800 00000 н. 0000418148 00000 н. 0000418520 00000 н. 0000418598 00000 н. 0000418676 00000 н. 0000419054 00000 н. 0000419570 00000 н. 0000419648 00000 н. 0000419726 00000 н. 0000420074 00000 н. 0000420446 00000 н. 0000420524 00000 н. 0000421060 00000 н. 0000421138 00000 н. 0000421546 00000 н. 0000421624 00000 н. 0000421702 00000 н. 0000422051 00000 н. 0000422424 00000 н. 0000422502 00000 н. 0000422580 00000 н. 0000422930 00000 н. 0000423302 00000 п. 0000430856 00000 п. 0000430935 00000 н. 0000431273 00000 н. 0000431351 00000 н. 0000431429 00000 н. 0000431507 00000 н. 0000431933 00000 н. 0000432468 00000 н. 0000432546 00000 н. 0000433076 00000 н. 0000433154 00000 п. 0000433562 00000 н. 0000433640 00000 н. 0000433718 00000 н. 0000434187 00000 п. 0000434703 00000 п. 0000434781 00000 п. 0000434859 00000 п. 0000435218 00000 п. 0000435733 00000 н. 0000435811 00000 н. 0000436220 00000 н. 0000436298 00000 н. 0000436376 00000 п. 0000436738 00000 н. 0000437161 00000 п. 0000437239 00000 п. 0000437317 00000 н. 0000437750 00000 н. 0000438215 00000 н. 0000438293 00000 п. 0000438371 00000 п. 0000438805 00000 п. 0000439276 00000 н. 0000445474 00000 п. 0000017379 00000 п. 0000016299 00000 н. трейлер ] / Назад 655082 / XRefStm 17379 >> startxref 0 %% EOF 1311 0 объект > поток h ޼] lTU vR @ cv.E ݖ` kE @ 4qY> hLLHI

Что старше, A или O?

Вопросы более технического характера

Что старше, A или O?

ВОПРОС

Я долгое время был сторонником и сторонником всей вашей работы. Однако есть один аспект, о котором я всегда думал. Следующее взято из статьи Википедии о диете по группе крови:

‘Луис К. де Маттос и Гарольдо В. Морейра указывают, что утверждения сторонников диет по группе крови о том, что группа крови O была первой группой крови человека, требуется что ген O развился раньше генов A и B в локусе ABO; Филогенетические сети человеческих и нечеловеческих аллелей ABO показывают, что ген A был первым, кто эволюционировал.Они утверждают, что с точки зрения эволюции было бы необычно, если бы нормальные гены (для типов A и B произошли от аномальных генов (для типа O). Ямамото и др. Далее отмечают: «Хотя группа крови O является распространен во всех популяциях по всему миру, нет никаких доказательств того, что ген O представляет собой предковый ген в локусе ABO. Также неразумно предполагать, что дефектный ген возник бы спонтанно, а затем превратился бы в нормальные гены. ‘

Если таковые имеются. Если это правда, то порочна сама основа диеты.Вы когда-нибудь писали ответ, опровергающий эти выводы? и если да, то как эти выводы могут так отличаться от ваших собственных?



ОТВЕТ

Еще один пример политики выборочного включения Википедии. В молекулярной истории тип A, по-видимому, является «самой старой» группой крови в том смысле, что мутации, которые привели к типам O и B, по-видимому, происходят от нее. Генетики называют это аллелем дикого типа или наследственным аллелем. Мутация типа B — это простая замена одной из букв ДНК в гене ABO другой; то, что генетики называют SNP (однонуклеотидный полиморфизм), и все произносят как «snip».«Мутация типа O гораздо интереснее: она возникла в результате полной потери буквы в ДНК ABO, и, как в поезде, когда товарный вагон убирают, все остальные вагоны просто движутся вверх по одному. Этот тип мутации называется сдвигом рамки считывания, и, что наиболее удивительно, практически каждая другая известная мутация сдвига рамки считывания является смертельной. Однако, если вы типа O, это сделало вас.

Однако, как я уже сказал, даже на молекулярном уровне гены много перемещаются. Хотя тип А является генетическим предком, похоже, что он исчез у людей очень давно, а затем «воскрес» около 300 000 лет назад.[REF: Kitano T1, Blancher A, Saitou N. Функциональный аллель A был восстановлен путем рекомбинации в гене группы крови человека ABO.Mol Biol Evol. 2012 Jul; 29 (7): 1791-6]. Это будет в соответствии с демографическими данными и поддержит теорию, которая выдвинула гипотезу о более значительном более раннем числовом присутствии для типа O.

Что еще более важно, какая бы теория об эволюционной истории группа крови оказывается правильной или неправильной, не имеет отношения к гораздо более серьезным соображениям, которые вы никогда не увидите в каких-либо статьях Википедии о диете.Это физиологические различия, которые, как известно, существуют между группами крови на фенотипическом уровне (особенно в отношении вариаций пищеварительных и иммунологических возможностей), и они решительно подтверждают фундаментальную науку, лежащую в основе диет.

Википедия известна своей позицией против альтернативной медицины и теорий диеты. Не дайте себя обмануть тем, кто хотел бы использовать этот аргумент, чтобы опровергнуть научные данные, стоящие за диетами по группам крови: предположения антропологов — это просто предположения, почему эти различия в физиологии и иммунологии возникли в первую очередь, и это те физиологические различия.

Leave a Reply

Добавить комментарий

Ваш адрес email не будет опубликован. Обязательные поля помечены *

2021 © Все права защищены.